DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and ras-2

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_497972.1 Gene:ras-2 / 175625 WormBaseID:WBGene00004311 Length:211 Species:Caenorhabditis elegans


Alignment Length:213 Identity:60/213 - (28%)
Similarity:97/213 - (45%) Gaps:22/213 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 DKREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAG 542
            |.:...||::|||:.|.||:|...::..:.|...|..|| .|..::..:.|.|.:: :.:.|.||
 Worm    12 DSKLPYYKLVVIGDGGVGKSSLTIQFFQKQFVDYYDPTI-EDQYIQHCEIDGNWVI-MDVLDTAG 74

  Fly   543 QERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEK 607
            ||.|..|...|.:...|..:||.||...:|:...|....:   :::.|.|..|.:|:|||.|...
 Worm    75 QEEFSAMREQYIRGGRGFLLVFSVTERKSFEEAHKLYNQV---LRVKDRSEYPVLLVANKVDLIN 136

  Fly   608 QGIITQPEKMDEYVRENGFAG-----WFETSAKE-NINIDEAARALVNKILINDKLISADLADGD 666
            |.::::.|..:       .|.     :.|||||| .:|:|.|...||..:    :...:|..|.:
 Worm   137 QRVVSEQEGRE-------LAAQLKLMYIETSAKEPPVNVDAAFHELVRIV----RSFPSDEGDHE 190

  Fly   667 KFNLSAADATGSDAKNKC 684
            ....|.........|.||
 Worm   191 ASMASVPRTKKRKDKGKC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 59/207 (29%)
RAB 484..652 CDD:197555 53/173 (31%)
ras-2NP_497972.1 M_R_Ras_like 16..180 CDD:133345 53/179 (30%)
small_GTPase 16..180 CDD:197466 53/179 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S223
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.