DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and Y71H2AM.12

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_497608.1 Gene:Y71H2AM.12 / 175389 WormBaseID:WBGene00022177 Length:195 Species:Caenorhabditis elegans


Alignment Length:188 Identity:58/188 - (30%)
Similarity:90/188 - (47%) Gaps:32/188 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 KILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGNM 549
            |::|:||.|.|||:.:..::...|..:...|||:||..|::|.:....:||||||.||||||..:
 Worm     8 KVVVVGESGAGKTALLTCFLDNTFETDPLTTIGIDFKHKIVQLNDGQSIRLQLWDTAGQERFRQL 72

  Fly   550 TRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCD--QEKQ---- 608
            ...|.:.|..|.:|.|::.....:.:.:||..:|..    .......|::.||.|  .||:    
 Worm    73 APAYIRSARVALLVIDLSDENCVEHLIRWKGIIDKN----KSDFTSTIIVGNKHDLVSEKRSPRL 133

  Fly   609 -GIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNK----------ILIND 655
             .||.  |..|||:         |||||...||.:...::..:          ||:|:
 Worm   134 TAIIR--ETNDEYI---------ETSAKMRKNIKKLFSSVACRPFPEHETSQIILLNE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 58/188 (31%)
RAB 484..652 CDD:197555 55/183 (30%)
Y71H2AM.12NP_497608.1 Ras 13..163 CDD:278499 53/164 (32%)
Rab 13..163 CDD:206640 53/164 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.