DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and Rab31

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_598446.2 Gene:Rab31 / 106572 MGIID:1914603 Length:195 Species:Mus musculus


Alignment Length:168 Identity:59/168 - (35%)
Similarity:88/168 - (52%) Gaps:9/168 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 KILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGNM 549
            |:.::|:.|.||:|.:.|:|...|..|...|||..|..|.:.. .|.:.:..:||.||||||.::
Mouse     8 KVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPC-GNELHKFLIWDTAGQERFHSL 71

  Fly   550 TRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIITQP 614
            ..:||:.:..|.||:|:|:..:|..:.||.::|  |...|:.  |...:..||||  ...|...|
Mouse    72 APMYYRGSAAAVIVYDITKQDSFHTLKKWVKEL--KEHGPEN--IVMAIAGNKCD--LSDIREVP 130

  Fly   615 EK-MDEYVRENGFAGWFETSAKENINIDEAARALVNKI 651
            .| ..||....| |...|||||..|||:|..:.:..:|
Mouse   131 LKDAKEYAESIG-AIVVETSAKNAINIEELFQGISRQI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 59/168 (35%)
RAB 484..652 CDD:197555 59/168 (35%)
Rab31NP_598446.2 Rab5_related 6..168 CDD:206653 59/168 (35%)
Ras 8..168 CDD:278499 59/168 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.