DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and rab38b

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:XP_003199402.2 Gene:rab38b / 100007788 ZFINID:ZDB-GENE-091204-345 Length:210 Species:Danio rerio


Alignment Length:210 Identity:131/210 - (62%)
Similarity:160/210 - (76%) Gaps:8/210 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 SDKREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIA 541
            ::::||||||||||:||.||||.|||||||.:|.|||||||||||||||.||:.| |||||||||
Zfish     3 NNQKEHLYKILVIGDLGVGKTSIIKRYVHQTYSTNYRATIGVDFALKVLNWDSET-VRLQLWDIA 66

  Fly   542 GQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQE 606
            |||||||||||||:||:||||||||||..||:.|||||||||||:.|.:|..|..:||||||||.
Zfish    67 GQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVSKWKEDLDSKLILSNGQSIATVLLANKCDQN 131

  Fly   607 KQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDK-LISADLADGDKFNL 670
            :..:.....|||:|.|||||.||||||||||:||::||..||..|:.::. ::.:.:.|      
Zfish   132 RDFLTNNGLKMDQYCRENGFVGWFETSAKENVNINDAANFLVKHIIASENDILKSVVPD------ 190

  Fly   671 SAADATGSDAKNKCS 685
            :.:....||.:..||
Zfish   191 TISPQLNSDKEMTCS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 128/203 (63%)
RAB 484..652 CDD:197555 122/167 (73%)
rab38bXP_003199402.2 Rab32_Rab38 10..202 CDD:206692 126/198 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001263
OrthoInspector 1 1.000 - - otm24755
orthoMCL 1 0.900 - - OOG6_103102
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1523
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.