powered by:
Protein Alignment Rme-8 and CG6693
DIOPT Version :9
Sequence 1: | NP_610467.1 |
Gene: | Rme-8 / 35939 |
FlyBaseID: | FBgn0015477 |
Length: | 2408 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001262473.1 |
Gene: | CG6693 / 41346 |
FlyBaseID: | FBgn0037878 |
Length: | 299 |
Species: | Drosophila melanogaster |
Alignment Length: | 42 |
Identity: | 13/42 - (30%) |
Similarity: | 25/42 - (59%) |
Gaps: | 5/42 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 1319 ESMIRKSYYKLAQMYHPDKNP-----NGREIFEKVNQAYEFL 1355
|..::|:|:||:.:.|||:.| ...|.|:.:::.|:.|
Fly 28 EKEVKKAYHKLSLLVHPDRVPEEQKAESTEKFKVLSKLYQVL 69
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45464441 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.