DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rme-8 and Csp

DIOPT Version :9

Sequence 1:NP_610467.1 Gene:Rme-8 / 35939 FlyBaseID:FBgn0015477 Length:2408 Species:Drosophila melanogaster
Sequence 2:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster


Alignment Length:81 Identity:29/81 - (35%)
Similarity:46/81 - (56%) Gaps:10/81 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1291 VEKKPPQMTIQQAYQDLGIDLTKTPKPDESMIRKSYYKLAQMYHPDKNP---NGREIFEKVNQAY 1352
            ::|:....:....|:.||  |.||...|:  |:|:|.|||..|||||||   :..:.|::||:|:
  Fly     6 MDKRKLSTSGDSLYEILG--LPKTATGDD--IKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAH 66

  Fly  1353 EFL---CSRNVWSSGG 1365
            ..|   ..||::.:.|
  Fly    67 SILSDQTKRNIYDNYG 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rme-8NP_610467.1 DUF4339 972..1020 CDD:290937
DnaJ 1304..1356 CDD:278647 25/57 (44%)
HEAT repeat 2174..2200 CDD:293787
HEAT repeat 2212..2243 CDD:293787
HEAT repeat 2253..2282 CDD:293787
HEAT repeat 2291..2327 CDD:293787
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 28/70 (40%)
DnaJ 17..79 CDD:278647 27/65 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.