DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rme-8 and CG10565

DIOPT Version :9

Sequence 1:NP_610467.1 Gene:Rme-8 / 35939 FlyBaseID:FBgn0015477 Length:2408 Species:Drosophila melanogaster
Sequence 2:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster


Alignment Length:676 Identity:117/676 - (17%)
Similarity:214/676 - (31%) Gaps:221/676 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1295 PPQMTIQQAYQDLGIDLTKTPKPDESMIRKSYYKLAQMYHPDK-NPNGREI------FEKVNQAY 1352
            |.:...|..|..||:...:. :..|..:|::|.::..::|||| ...|.|:      |..:.:||
  Fly    69 PKEWKDQDHYAVLGLGKLRY-EASEDDVRRAYRRMVLLHHPDKRKAKGEEVIQDDDYFTCITKAY 132

  Fly  1353 EFLCS---RNVWSSGGPDPNNIVLILRTQSILFERYPDVLRPY-----KYAGYPQLIKTIRLETR 1409
            |.|.:   |..:.|..|:.::   .|.:|:.:...|..|...:     :::..|.:....:::.:
  Fly   133 EILGTSKPRRSFDSVDPEFDD---SLPSQNDIDNDYFGVFNKFFTLNGRWSEKPHVPSFGQVDAK 194

  Fly  1410 DDELFSKEAQLLTAASELCYHTVH-------CSALNAEELRREEGIE----ALLEAYTRCVSILG 1463
            .:|:            |..|:..:       .|.|:.|:  :|:|.:    ..:|...|...|  
  Fly   195 REEV------------ERFYNFWYDFKSWREFSYLDEED--KEKGQDRDERRWIEKENRAARI-- 243

  Fly  1464 VDSKPDSLHYQVISNVTRCFEVACNFEKCKQKIIQLPQLLSDVCRVVYFKHTLSVSLVTSLAANN 1528
             ..|.:.:     |.:....::|.|.:|                |:..||.........:..|..
  Fly   244 -KRKKEEM-----SRIRSLVDLAYNNDK----------------RIQRFKQEEKDRKAAAKRAKM 286

  Fly  1529 YDLQCQLSRNGVLWSLLLFIFEYDYTLDESGV--DVSDKSNQQQLANNLAKMAVLGCIALAGYSM 1591
            ...|.|.:             |.|..:.|:.:  :.::|:.|::                     
  Fly   287 DAAQAQKA-------------EADRAIREAALAKEKAEKAEQKR--------------------- 317

  Fly  1592 ELRQKPVTGSETNSPAAKAPPVIKPKPSVSAASSSTYTQNAHNPLQSKQLAITSGKEKESDT--- 1653
             :.|..:...:......|....::.|    ......|.:|     ...||....|.||..:|   
  Fly   318 -IEQIRIEREQQKKLLKKERKTLRDK----VKDCKYYAKN-----DKDQLKHMEGTEKICETFNL 372

  Fly  1654 -----------SSGSSDTASSTPT---------ESEQQQQLTKTRTSA--------IQQKYIVTG 1690
                       |.|.....::..|         |...|.|..|..:||        :::..:.:.
  Fly   373 AELQALNKAMESKGRESFVAALQTAEQKIAAELEEINQTQAKKLASSAATPKGVKEVKKNELWSN 437

  Fly  1691 EAKNSLIK-------------QVLDRLLTRYISNQLATVRDSDVLKLLTA--NTRNPYLIWDNGT 1740
            |....|||             .|:...:.::..:....|...|||....|  ||        :.:
  Fly   438 ENVQLLIKAVNLFPAGTAQRWDVIATFINQHSPDNTVLVNARDVLNKAKALQNT--------DHS 494

  Fly  1741 RAQLKDFLEQQRTASAKETHEDIAQVSELVSSFE-FDAHKDELQIGGIFIRIYNDMPTHPIAQPK 1804
            ::.||........||.:::.:|:....::....| ..|.|:.|:..|:..:..|           
  Fly   495 KSSLKTQANDAAFASFEKSKKDVQTCKDITLGEETAQASKENLKQNGVDHKANN----------- 548

  Fly  1805 LFIMDLLEYLKHAYQFLQYKKNPASTAAPVNATPKMGNDGILTPTLAPNHPQLQQASTGKSGTTF 1869
                             |..|...:..||.|            ||.||........|||....  
  Fly   549 -----------------QSTKQNGTAPAPAN------------PTAAPAPVPATNGSTGGGAA-- 582

  Fly  1870 DEVLTAYNRSKSRKKLETDALTEQQL 1895
                     ||:..| |..||.||.:
  Fly   583 ---------SKTWTK-EEQALLEQAI 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rme-8NP_610467.1 DUF4339 972..1020 CDD:290937
DnaJ 1304..1356 CDD:278647 16/58 (28%)
HEAT repeat 2174..2200 CDD:293787
HEAT repeat 2212..2243 CDD:293787
HEAT repeat 2253..2282 CDD:293787
HEAT repeat 2291..2327 CDD:293787
CG10565NP_001246856.1 CbpA 76..282 CDD:225124 44/247 (18%)
DnaJ 76..145 CDD:278647 18/69 (26%)
RILP-like 268..>344 CDD:304877 13/114 (11%)
RAC_head 332..401 CDD:293322 13/77 (17%)
SANT 584..633 CDD:197842 7/16 (44%)
SANT 585..632 CDD:238096 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.