DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rme-8 and Tpr2

DIOPT Version :9

Sequence 1:NP_610467.1 Gene:Rme-8 / 35939 FlyBaseID:FBgn0015477 Length:2408 Species:Drosophila melanogaster
Sequence 2:NP_001260501.1 Gene:Tpr2 / 34984 FlyBaseID:FBgn0032586 Length:508 Species:Drosophila melanogaster


Alignment Length:427 Identity:82/427 - (19%)
Similarity:155/427 - (36%) Gaps:108/427 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   998 WQKGLITPKTRCWAIG--MDGWRSLQQIPQLKWCLIAKGTPLYDETELSSKILDILIKCTSFFPS 1060
            ::|..:.....|.|:|  :...::::.:.:|.    :..|.:..|...:.|:..:.....:.:.:
  Fly   116 FEKAYVRVAKCCLALGDIIGTEQAVKMVNELN----SLSTAVAAEQTAAQKLRQLEATIQANYDT 176

  Fly  1061 RTQNGV------AVLIPGPKLSRKLSEFICLPHVVQVCLTHDPGLLERVATLLYQIME-DNPEMP 1118
            ::...|      |:.:....|..:|.:..||..:         |..:....:...:|: |.....
  Fly   177 KSYRNVVFYLDSALKLAPACLKYRLLKAECLAFL---------GRCDEALDIAVSVMKLDTTSAD 232

  Fly  1119 KVYLTGVFYFMLMYTGS---NILPITRFLKM--THMKQGFRSEETSQSGIMHRSILGQLLPEAMV 1178
            .:|:.|:   .|.||.:   .||...|.|.:  .|.|......:..|...|..:  |.:|.::  
  Fly   233 AIYVRGL---CLYYTDNLDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKEN--GNMLFKS-- 290

  Fly  1179 CFLENYSAEKFAEIFLGEFDTPEVIWSSEMRRLLIEKIAAHIADFTPRL---RGHTMARYPYLAI 1240
                            |.:....||::..:      ||..|..|...:|   |.....|...|..
  Fly   291 ----------------GRYREAHVIYTDAL------KIDEHNKDINSKLLYNRALVNTRIGNLRE 333

  Fly  1241 PVISYPQ-LE-NELFCHIYYLRHLC--DTQKFPNWPISDPVQLLKHTLDAWRKEVEKKPPQMTIQ 1301
            .|....: || |..:.....||..|  |.:||.. .::|....|         ::||.|   .|:
  Fly   334 AVADCNRVLELNSQYLKALLLRARCYNDLEKFEE-SVADYETAL---------QLEKTP---EIK 385

  Fly  1302 QAYQDLGIDLTKTPKPD------------ESMIRKSYYKLAQMYHPDKNPNG-------REI-FE 1346
            :..::....|.|:.:.|            :..|:|:|.|.|.::|||::.|.       .|: |:
  Fly   386 RMLREAKFALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFK 450

  Fly  1347 KVNQAYEFLC---SRNVWSSGGP---------DPNNI 1371
            :|.:||..|.   .::.:.||..         |||.:
  Fly   451 EVGEAYAILSDAHKKSRYDSGQDIEEQEQADFDPNQM 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rme-8NP_610467.1 DUF4339 972..1020 CDD:290937 4/23 (17%)
DnaJ 1304..1356 CDD:278647 17/71 (24%)
HEAT repeat 2174..2200 CDD:293787
HEAT repeat 2212..2243 CDD:293787
HEAT repeat 2253..2282 CDD:293787
HEAT repeat 2291..2327 CDD:293787
Tpr2NP_001260501.1 TPR_11 49..114 CDD:290150
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
TPR_11 201..262 CDD:290150 15/72 (21%)
TPR repeat 201..225 CDD:276809 4/32 (13%)
TPR_1 231..264 CDD:278916 9/35 (26%)
TPR repeat 231..259 CDD:276809 8/30 (27%)
TPR_11 278..345 CDD:290150 17/92 (18%)
TPR repeat 310..344 CDD:276809 7/33 (21%)
TPR_11 314..380 CDD:290150 16/75 (21%)
TPR repeat 349..377 CDD:276809 8/37 (22%)
DnaJ 401..>503 CDD:223560 21/87 (24%)
DnaJ 402..469 CDD:278647 16/66 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464417
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.