DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rme-8 and l(3)80Fg

DIOPT Version :10

Sequence 1:NP_610467.1 Gene:Rme-8 / 35939 FlyBaseID:FBgn0015477 Length:2408 Species:Drosophila melanogaster
Sequence 2:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster


Alignment Length:289 Identity:52/289 - (17%)
Similarity:101/289 - (34%) Gaps:123/289 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly  1252 LFCHIYYLRHLCDTQKFPNWPISDPVQLLKHTLDAWRKEVEKKPPQMTIQQAYQDLGIDLTKTPK 1316
            :.|...|: |:|.:       ::||                           |..|||:    .|
  Fly    15 VLCTTSYI-HVCSS-------LNDP---------------------------YAILGIN----KK 40

  Fly  1317 PDESMIRKSYYKLAQMYHPD--KNPNGREIFEKVNQAYEFLCSRNVWSSGGPDPNNIVLILRTQS 1379
            .....||::|.:||:.:|||  ||..|.|.|.::..|||.|...:                  :.
  Fly    41 ATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLD------------------RR 87

  Fly  1380 ILFERY--PDVLRPY-----KYAGYPQLIKTI---------RLETRDDELF-------------- 1414
            .:|:||  .|:...|     .|:.|.:.  |:         |.:.:.|..|              
  Fly    88 RIFDRYGVSDINSQYFQKKHDYSEYNRF--TLNQNDDDFGQRFDIKQDIAFYQKLSITENYFEKM 150

  Fly  1415 -----SKEAQLLTAASELCYHTVHCSALNAEELRREEGIEALLEAYTRCVSILGVDSKPDSLHYQ 1474
                 :|:..::...::.|:   .|:              .:::|:.:.:.:|    :|..:::.
  Fly   151 ILSKNAKKVHVVMFYNDWCF---KCT--------------RIVDAFKKILELL----QPIGINFA 194

  Fly  1475 VISNVTRCFEVACNFEKCKQKIIQLPQLL 1503
            .::.|    .....|.||..:  ::|||:
  Fly   195 TVNAV----HEESVFRKCGAR--EVPQLV 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rme-8NP_610467.1 RME-8_N 12..835 CDD:466078
GYF_2 972..1026 CDD:464112
DnaJ 1304..1356 CDD:395170 21/53 (40%)
HEAT repeat 2174..2200 CDD:293787
HEAT repeat 2212..2243 CDD:293787
HEAT repeat 2253..2282 CDD:293787
HEAT repeat 2291..2327 CDD:293787
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:440252 26/112 (23%)
TRX_DnaJ 134..244 CDD:239261 14/111 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.