DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rme-8 and CG7556

DIOPT Version :9

Sequence 1:NP_610467.1 Gene:Rme-8 / 35939 FlyBaseID:FBgn0015477 Length:2408 Species:Drosophila melanogaster
Sequence 2:NP_001285427.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster


Alignment Length:566 Identity:103/566 - (18%)
Similarity:189/566 - (33%) Gaps:197/566 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1286 AWRKE-------VEKKPPQMTIQQAYQDLGIDLTKTPKPDESMIRKSYYKLAQMYHPDKNP--NG 1341
            ||..|       ||:     ..:..|:.:||:.|.|    .:.:::::..|:.:.||||||  :.
  Fly    22 AWHSEELEIFDLVEE-----VNRNFYEFMGINQTAT----GAEVKRAFRTLSIVLHPDKNPAEDA 77

  Fly  1342 REIFEKVNQAYEFLCSRNVWSSGGPDPNNIVLILRTQSILFERYPDVLRP----YKYA-GYPQLI 1401
            ...|..:...||.|          .||:.           .|:|..||:.    :|.| .|.:.:
  Fly    78 NIQFRNLVSIYEVL----------KDPSR-----------REKYDRVLKEGMPNWKSALYYYRRM 121

  Fly  1402 KTIRLETRDDELFSKEAQLLTAASELCYHTVHCSALNAEELRREEGIEALLEAYTRCVSILGVDS 1466
            :.|.|......||     |:|...:..:                 ...|.||.......:.|...
  Fly   122 RKIGLYEGAFILF-----LITTVGQYLF-----------------AWAAYLEKKYTAEQVFGTKL 164

  Fly  1467 KPDSLHYQVISNVTRCFEVACNFEKCKQKIIQLPQLLSDVCRVVYFKHTLSVSLVTSLAANNYDL 1531
            |                    ..:| |.|.|.:..:||::             .:.|| .|...:
  Fly   165 K--------------------KLQK-KNKNIDMDVILSEI-------------PMPSL-LNTLPI 194

  Fly  1532 QCQLSRNGVLWSLLLFIFE--------YDYTLDESGVDVSDKSNQQQLANNLAKMAVLGC----- 1583
            |..|:    ||:|...|..        .:..|::...::.....|::|.....:.|.|..     
  Fly   195 QIPLA----LWNLPRTIKNGFSKANELKELALEKRRQELEAVRRQEELEREAEEQARLRKEHKEN 255

  Fly  1584 ---------------IALAGYSMELRQKPVTGSETNSPAAKAPPV----------------IKPK 1617
                           ..|.||| :::.:.:|..:...||::...|                :|..
  Fly   256 LRKRKQNSKAPEKTEEELRGYS-QIQTRELTDDDAVRPASQKSTVSGGFWTDEDLTELIRLVKKY 319

  Fly  1618 PSVSAASSSTYTQNAHNPLQSKQLAITSGKEKESD-TSSGSSDT-ASSTPTESEQQQQLTKTRTS 1680
            |..:.:..:|..::.:..:|  ::...:.|.||:. ...|.:|: |.:...||:|.|:..|.:.:
  Fly   320 PGGAGSRWNTIAESMNRSVQ--EVTFMAAKMKENGYRIPGQTDSVAEALVQESQQAQRKEKVKKA 382

  Fly  1681 AIQQKYIVTGEAKNSLI----------KQVLDRLLTRY-----------ISNQLATVRDSDVLKL 1724
            |..    ....|:.|::          ::.|:..:.:|           |:|.:......:.|  
  Fly   383 AAN----AGASAEKSMLIPETNWTQEQQRALEAAIVKYRKTAGGDRWQKIANSVPEKTKEECL-- 441

  Fly  1725 LTANTRNPYLIWDNGTRAQLKDFLEQQRTA--SAKETHEDIAQVSE 1768
                .|..||.          :.::.|:.|  .|.|..||.|.:.|
  Fly   442 ----VRYKYLC----------ELVKTQKRAEEEANEPDEDAAAIEE 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rme-8NP_610467.1 DUF4339 972..1020 CDD:290937
DnaJ 1304..1356 CDD:278647 15/53 (28%)
HEAT repeat 2174..2200 CDD:293787
HEAT repeat 2212..2243 CDD:293787
HEAT repeat 2253..2282 CDD:293787
HEAT repeat 2291..2327 CDD:293787
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 19/85 (22%)
SANT 301..>341 CDD:197842 4/41 (10%)
SANT 304..341 CDD:238096 4/38 (11%)
SANT 399..447 CDD:197842 6/53 (11%)
SANT 400..447 CDD:238096 6/52 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464387
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.