DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and DMC1

DIOPT Version :9

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_011106.1 Gene:DMC1 / 856926 SGDID:S000000981 Length:334 Species:Saccharomyces cerevisiae


Alignment Length:351 Identity:75/351 - (21%)
Similarity:138/351 - (39%) Gaps:73/351 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSEYQLNL-----LRKNNICSLIDFYDADEKKLHELWAINIQSVRELKK------ELSLLPKG-S 68
            |..|.:|.     |:...|.::........:.|.::..::...|.::|:      ::..:|.. .
Yeast    22 LQNYGINASDLQKLKSGGIYTVNTVLSTTRRHLCKIKGLSEVKVEKIKEAAGKIIQVGFIPATVQ 86

  Fly    69 VDEGTPDFNYDTGIEELDKLLDSVEQPFKPGRVWELCGQPGVGKTQLLYTLALNFVWKHSQA--- 130
            :|.....::..||.::||.:|........   :.|:.|:...||||:.:||.:.........   
Yeast    87 LDIRQRVYSLSTGSKQLDSILGGGIMTMS---ITEVFGEFRCGKTQMSHTLCVTTQLPREMGGGE 148

  Fly   131 --VLFIDTKREFSCKRIQDMLRAREVDEEASERAMKGIRVVQAATGADINDLLKSFDHQLTAETH 193
              |.:|||:..|..:||:.:....|:|.|:   .:..:...:|.......:|::....:|::..:
Yeast   149 GKVAYIDTEGTFRPERIKQIAEGYELDPES---CLANVSYARALNSEHQMELVEQLGEELSSGDY 210

  Fly   194 ASMQTKLVLIDSLAACFAF-YRGRRMRDVRKSVLTELACKIRKLALRGVAFVIGNVSFFENNKDS 257
                 :|:::||:.|.|.. |.||.....|:..|.:...|:.:||..      .||:.|..|:..
Yeast   211 -----RLIVVDSIMANFRVDYCGRGELSERQQKLNQHLFKLNRLAEE------FNVAVFLTNQVQ 264

  Fly   258 CGDDGEQ----NGDDEE-----------VTRQQLEPMLGSYWSSVATLRLSVELPEEEDFTLQDD 307
             .|.|..    :.|..:           .||..|....|.  ..||.|:.|.::||:|       
Yeast   265 -SDPGASALFASADGRKPIGGHVLAHASATRILLRKGRGD--ERVAKLQDSPDMPEKE------- 319

  Fly   308 GLRFIYVISNTYGPDGEHCLLRITDA 333
               .:|||    |..|      |||:
Yeast   320 ---CVYVI----GEKG------ITDS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 65/275 (24%)
radB 80..335 CDD:236482 65/275 (24%)
DMC1NP_011106.1 recomb_DMC1 19..332 CDD:131292 74/349 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.