DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and RAD51

DIOPT Version :9

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_011021.3 Gene:RAD51 / 856831 SGDID:S000000897 Length:400 Species:Saccharomyces cerevisiae


Alignment Length:340 Identity:82/340 - (24%)
Similarity:130/340 - (38%) Gaps:109/340 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ADEKKLHE---------LWA-----INIQSVRELKKE------LSLLPKGSVDEGTPDFN----- 77
            ||.|||.|         .:|     :.|:.:.|.|.:      ..|:|.|.|.  ..||:     
Yeast    94 ADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVT--AADFHMRRSE 156

  Fly    78 ---YDTGIEELDKLL-DSVEQPFKPGRVWELCGQPGVGKTQLLYTLALNF-----VWKHSQAVLF 133
               ..||.:.||.|| ..||    .|.:.||.|:...||:||.:|||:..     :.......|:
Yeast   157 LICLTTGSKNLDTLLGGGVE----TGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLY 217

  Fly   134 IDTKREFSCKRIQDMLRAREVDEEASERAMKGIRVVQAAT--GADINDLLKSF--------DHQL 188
            |||:..|                       :.:|:|..|.  |.|.:|.|.:.        ||||
Yeast   218 IDTEGTF-----------------------RPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQL 259

  Fly   189 -----TAETHASMQTKLVLIDSLAACF-AFYRGRRMRDVRKSVLTELACKIRKLALR-GVAFVIG 246
                 .|:..:..:..|:::||:.|.: ..:.||.....|:..|.:....:::||.: |||.|:.
Yeast   260 RLLDAAAQMMSESRFSLIVVDSVMALYRTDFSGRGELSARQMHLAKFMRALQRLADQFGVAVVVT 324

  Fly   247 NVSFFENNKDSCGDDGEQNGDDEEVTRQQLEPMLGSYWSSVATLRLSVE---------------- 295
            |....:      .|.|.....|.:      :|:.|:..:..:|.||..:                
Yeast   325 NQVVAQ------VDGGMAFNPDPK------KPIGGNIMAHSSTTRLGFKKGKGCQRLCKVVDSPC 377

  Fly   296 LPEEE-DFTLQDDGL 309
            |||.| .|.:.:||:
Yeast   378 LPEAECVFAIYEDGV 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 66/270 (24%)
radB 80..335 CDD:236482 66/270 (24%)
RAD51NP_011021.3 recomb_RAD51 83..397 CDD:274048 82/340 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.