DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and XRCC2

DIOPT Version :9

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001330643.1 Gene:XRCC2 / 836573 AraportID:AT5G64520 Length:378 Species:Arabidopsis thaliana


Alignment Length:268 Identity:52/268 - (19%)
Similarity:91/268 - (33%) Gaps:71/268 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PFKPGRVWELCGQPGVGKTQLLYTLALNFV----WK--H----SQAVLFIDTKREFSCKRIQDML 149
            |.:.|.|.|:.|.....|||:|...|::.:    |.  |    .:.|||:|....|...|:..||
plant    39 PLRAGNVVEITGASTSAKTQILIQAAISCILPKTWNGIHYGGLGKLVLFLDLDCRFDVLRLSQML 103

  Fly   150 RAREV--------------------------------DEEASERAMKGIRVVQAATGADINDLLK 182
            :.|.:                                |||.....||....|:.....::...||
plant   104 KHRLLQANWLGNGAWWQLEESNVKSCKSAEEKTKTVFDEELYASCMKRFLYVRCYDSLELLSSLK 168

  Fly   183 SF------DHQLTAETHASMQTKLVLIDSLAACFAFYRGRRMRDV-------RKS-----VLTEL 229
            .|      .:::..:.....|..:::|||:.   ||:...|:...       |||     |:..:
plant   169 YFTVLQTLHYRIQQQEACGSQVGVLMIDSIG---AFHWTDRLSSSLALETHNRKSLSLTNVVETI 230

  Fly   230 ACKIRKLALRGVAFVIGNVSFF--------ENNKDSCGDDGEQNGDDEEVTRQQLEPMLGSYWSS 286
            ..:::||.|.....|:......        |||:....:|........:..:......:.|.|.:
plant   231 VQELKKLLLVHSLVVLATKGTIYEEKYPANENNRKVSSNDHFSGNVASKAQQPPFREFMPSSWQA 295

  Fly   287 VATLRLSV 294
            ..|.::.:
plant   296 FVTHKIII 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 52/268 (19%)
radB 80..335 CDD:236482 52/268 (19%)
XRCC2NP_001330643.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.