DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and XRCC3

DIOPT Version :9

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001093588.1 Gene:XRCC3 / 7517 HGNCID:12830 Length:346 Species:Homo sapiens


Alignment Length:373 Identity:86/373 - (23%)
Similarity:145/373 - (38%) Gaps:79/373 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLRPMILQTCTGRLLSEYQLNLLRKNNICSLIDFYDADEKKL-----HELWAI----------- 49
            :||.|.|:..          :...:..::..::.|...|.|:|     .|:|.:           
Human     6 LDLNPRIIAA----------IKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGS 60

  Fly    50 NIQSVRELKKELSLLPKGSVDEGTPDFNYDTGIEELDKL------LDSVEQPFKPGRVWELCGQP 108
            :|.:..:|.::....|       |.......|...||.|      ||.:.         ||.|:.
Human    61 SILTALQLHQQKERFP-------TQHQRLSLGCPVLDALLRGGLPLDGIT---------ELAGRS 109

  Fly   109 GVGKTQLL--YTLALNFVWKH---SQAVLFIDTKREFSCKRIQDML----RAR-EVDEEASERAM 163
            ..|||||.  ..||:.|..:|   ....::|.|:..|..||:|.::    |.| :|..|..::..
Human   110 SAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLR 174

  Fly   164 KGIRVVQAATGADINDLLKSFDHQLTAETHASMQTKLVLIDSLAACFAFYRGRRMRDVRKSVLTE 228
            .|.::..... ||::.||:..:.::.......| .:||:|||:||.|......:....|...|..
Human   175 FGSQIFIEHV-ADVDTLLECVNKKVPVLLSRGM-ARLVVIDSVAAPFRCEFDSQASAPRARHLQS 237

  Fly   229 LACKIRKL--ALRGVAFVIGNVSFFENNKDSCGDDGEQNGD----DEEVTRQQLEPMLGSYWSSV 287
            |...:|:|  |.:.....|..|:      ::..:.|..:|.    ||.|:     |.||..|::.
Human   238 LGATLRELSSAFQSPVLCINQVT------EAMEEQGAAHGPLGFWDERVS-----PALGITWANQ 291

  Fly   288 ATLRLSVELPEEEDFTLQDDGLRFIYVISNTYGPDGEHCLLRITDAGV 335
            ..:||..:...||:..|.... |.:.|:|..:.|... |...|:..||
Human   292 LLVRLLADRLREEEAALGCPA-RTLRVLSAPHLPPSS-CSYTISAEGV 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 72/278 (26%)
radB 80..335 CDD:236482 70/276 (25%)
XRCC3NP_001093588.1 Rad51_DMC1_radA 82..338 CDD:238543 72/280 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158705
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.