DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and RAD51C

DIOPT Version :9

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_006722064.1 Gene:RAD51C / 5889 HGNCID:9820 Length:377 Species:Homo sapiens


Alignment Length:269 Identity:61/269 - (22%)
Similarity:99/269 - (36%) Gaps:91/269 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 ELCGQPGVGKTQLLYTLALN------FVWKHSQAVLFIDTKREFSCKRIQDMLRAREVDEEASER 161
            |:||.||||||||...||::      |.....:|| ||||:..|...|:.|:..|          
Human   122 EICGAPGVGKTQLCMQLAVDVQIPECFGGVAGEAV-FIDTEGSFMVDRVVDLATA---------- 175

  Fly   162 AMKGIRVVQAATGADINDLLKSFDH-QLTAETHASMQTKLVL----IDSLAACFAFYRGRRMRDV 221
                                 ...| ||.||.|...:.:..|    :|::.:...::|.|...::
Human   176 ---------------------CIQHLQLIAEKHKGEEHRKALEDFTLDNILSHIYYFRCRDYTEL 219

  Fly   222 RKSV------LTELACKIRKLALRGVAFVIGN-------------------VSFFENNKDSCGDD 261
            ...|      |:|.: |:|.:.:.|:||...:                   :|...|::.:....
Human   220 LAQVYLLPDFLSEHS-KVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILT 283

  Fly   262 GEQNGDDEEVTRQQ--LEPMLGSYWSSVATLRL-------------SVELPEEED----FTLQDD 307
            .:..   .::.|.|  |.|.||..|...||:||             ..:.|.:::    |.::..
Human   284 NQMT---TKIDRNQALLVPALGESWGHAATIRLIFHWDRKQSRLATLYKSPSQKECTVLFQIKPQ 345

  Fly   308 GLRFIYVIS 316
            |.|...|.|
Human   346 GFRDTVVTS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 61/269 (23%)
radB 80..335 CDD:236482 61/269 (23%)
RAD51CXP_006722064.1 HHH_5 12..57 CDD:291205
recomb_radA 21..349 CDD:131290 58/262 (22%)
Rad51_DMC1_radA 100..348 CDD:238543 58/261 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.