DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and rad51c

DIOPT Version :9

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001016923.1 Gene:rad51c / 548416 XenbaseID:XB-GENE-1015191 Length:361 Species:Xenopus tropicalis


Alignment Length:236 Identity:58/236 - (24%)
Similarity:95/236 - (40%) Gaps:64/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RVWELCGQPGVGKTQLLYTLALN------FVWKHSQAVLFIDTKREFSCKRIQDMLRA------- 151
            ::.|:||.||||||||...||::      |.....:.| ||||:..|..:|:.|:..|       
 Frog   105 KITEICGVPGVGKTQLCMQLAVDVQIPECFGGVAGETV-FIDTECSFRLERLMDIANACVQHCNL 168

  Fly   152 -----REVDEEASERAMKGIRVVQAATGADINDLLKSFDH-------QLTAETH-------ASMQ 197
                 ::.|.         |:.:|..|   :|::|....:       :|.|:.:       :..:
 Frog   169 IAQGHQDKDH---------IKAMQTFT---LNEILSQIYYFSCHDYIELLAQINLLPDFLSSHPK 221

  Fly   198 TKLVLIDSLAACFAFYRGRRMRDVRKSVLTELACKIRKLALR-GVAFVIGNVSFFENNKDSCGDD 261
            .|||:|||:|  |.|........:|..:|.....::..||.. .:|.|:.|..   ..|....| 
 Frog   222 VKLVVIDSIA--FPFRHSFEDLSLRTRLLNGFGQQLISLAHNCNLAVVLTNQM---TTKIGPSD- 280

  Fly   262 GEQNGDDEEVTRQQLEPMLGSYWSSVATLRLSVELPEEEDF 302
                        .:|.|.||..|...:|:||.:....::.|
 Frog   281 ------------SKLVPALGESWGHASTIRLILHWKSKQRF 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 58/236 (25%)
radB 80..335 CDD:236482 58/236 (25%)
rad51cNP_001016923.1 Rad51_DMC1_radA 86..333 CDD:238543 58/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.