DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and Dmc1

DIOPT Version :9

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001124039.1 Gene:Dmc1 / 362960 RGDID:1307611 Length:340 Species:Rattus norvegicus


Alignment Length:334 Identity:76/334 - (22%)
Similarity:142/334 - (42%) Gaps:63/334 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLSEYQLNL-----LRKNNICSLIDFYDADEKKLHELWAINIQSVRELKKELS-LLPKGSV---- 69
            ||.::.:|:     |:...||::........:.|..:..::...|.::|:..: |:..|.:    
  Rat    26 LLQKHGINMADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVEKIKEAANKLIEPGFLTAFQ 90

  Fly    70 --DEGTPDFNYDTGIEELDKLL-DSVEQPFKPGRVWELCGQPGVGKTQLLYTLALNFVWKHSQA- 130
              ::....|:..||.:|.|||| ..:|..    .:.|..|:...|||||.:||.:......:.. 
  Rat    91 YSEKRKMVFHITTGSQEFDKLLGGGIESM----AITEAFGEFRTGKTQLSHTLCVTAQLPGADGY 151

  Fly   131 ----VLFIDTKREFSCKRIQDMLRAREVDEEASERAMKGIRVVQAATGADINDLLKSFDHQLTAE 191
                ::||||:..|...|::|:.....||.:|   .:..:...:|.|.....:||   |: :.|:
  Rat   152 SGGKIIFIDTENTFRPDRLRDIADRFNVDHDA---VLDNVLYARAYTSEHQMELL---DY-VAAK 209

  Fly   192 THASMQT-KLVLIDSLAACFAF-YRGRRMRDVRKSVLTELACKIRKLALRGVAFVIGNVSFFENN 254
            .|..... ||:::||:.|.|.. :.||.....|:..|.::..:::|::..      .||:.|..|
  Rat   210 FHEEAGIFKLLIVDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEE------YNVAVFVTN 268

  Fly   255 KDSCGDDGEQNGDDEEVTRQ--QLEPMLGSYWSSVATLRLSV----------------ELPEEE- 300
            : ...|.|      ..:|.|  ..:|:.|...:..:|.|:|:                |:||.| 
  Rat   269 Q-MTADPG------ATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEA 326

  Fly   301 DFTLQDDGL 309
            .|.:...|:
  Rat   327 TFAITTGGI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 64/257 (25%)
radB 80..335 CDD:236482 64/257 (25%)
Dmc1NP_001124039.1 recomb_DMC1 24..338 CDD:131292 76/334 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.