DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and rhp55

DIOPT Version :9

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_593604.1 Gene:rhp55 / 2543685 PomBaseID:SPAC3C7.03c Length:350 Species:Schizosaccharomyces pombe


Alignment Length:207 Identity:51/207 - (24%)
Similarity:94/207 - (45%) Gaps:44/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PDFNYDTGIEELDKLLDSV--EQPFKPGRVWELCGQPGVGKTQLLYTLALNFVWKHSQAVLFIDT 136
            |.|.:::      ||||..  ....|.|.:.|:||.||:|||.|...:..|.:...|: |::::|
pombe    23 PGFGFNS------KLLDDAFGGSGLKRGYISEVCGAPGMGKTSLALQITANALLSGSR-VIWVET 80

  Fly   137 KREFSCKRIQDML-----RAREVDEEA-SERAMKGIRVVQAATGADINDLLKSFDHQLTAETHAS 195
            .:....:|::.:|     .:::.:|:. ::..:..:.||.|....:|...|::||.    |.|..
pombe    81 CQPIPMERLRQLLDNHVPSSQDEEEKCDTDELLNLLDVVYAPNLVNILAFLRNFDQ----EKHLK 141

  Fly   196 MQTKLVLIDSLA-----------ACFAFYRGRRMRDVRKSVLTELACKIRKLALRGVAFVIGNVS 249
             :..|::||:|:           ..:|:.|.|| ...:||.|::.:.|...|.|.          
pombe   142 -EIGLLIIDNLSMPIQLAYPTSPEDYAYLRLRR-NTSKKSSLSDSSQKENTLTLN---------- 194

  Fly   250 FFENNKDSCGDD 261
              :.|:.|..||
pombe   195 --KENEFSSKDD 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 49/201 (24%)
radB 80..335 CDD:236482 49/201 (24%)
rhp55NP_593604.1 RecA 1..295 CDD:223544 51/207 (25%)
P-loop_NTPase 29..327 CDD:304359 49/201 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006192
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4853
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.