DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and Rad51b

DIOPT Version :9

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_030102481.1 Gene:Rad51b / 19363 MGIID:1099436 Length:381 Species:Mus musculus


Alignment Length:361 Identity:80/361 - (22%)
Similarity:129/361 - (35%) Gaps:109/361 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSEYQ------------LNLLRKNNICSLIDFYDADEKKLH---ELWAINIQSVRELKKELSLLP 65
            ||.||            |.|::...:.     |....:.||   :..|..:|:..|||...|.  
Mouse    30 LSRYQIVNCQHFLSLSPLELMKVTGLS-----YRGVHELLHTVSKACAPQMQTAYELKTRRSA-- 87

  Fly    66 KGSVDEGTPDFNYDTGIEELDKLLDSVEQPFKPGRVWELCGQPGVGKTQ------LLYTLALNFV 124
                 ..:|.| ..|.:..||:.|..   ....|.:.|:.|.||.||||      :|.||..:..
Mouse    88 -----HLSPAF-LSTTLCALDEALHG---GVPCGSLTEITGPPGCGKTQFCIMMSVLATLPTSLG 143

  Fly   125 WKHSQAVLFIDTKREFSCKRIQDMLRAREVD----EEASERAMKGIRVVQAATGADINDLLKSFD 185
            .... ||::|||:..|:.:|:.::..:|...    ||........:.:.:..|...:...|:|.:
Mouse   144 GLEG-AVVYIDTESAFTAERLVEIAESRFPQYFNTEEKLLLTSSRVHLCRELTCEGLLQRLESLE 207

  Fly   186 HQLTAETHASMQTKLVLIDSLAACFAFYRGRRMRDVRKSVLTELACKIR---KLALRGVA---FV 244
            .::     .|...|||::||:|:.           |||....:|...|:   |...:|.:   ::
Mouse   208 EEI-----ISKGVKLVIVDSIASV-----------VRKEFDPKLQGNIKERNKFLGKGASLLKYL 256

  Fly   245 IGNVSFFENNKDSCGDDGEQ--------NGDDEEVTRQQLEPMLGSYWSSVATLRLSVELPEEED 301
            .|..|.          .||:        :|....:|.|             .|..||..||.:.|
Mouse   257 AGEFSI----------PGERKMPATSASSGGKVILTNQ-------------ITTHLSGALPSQAD 298

  Fly   302 FTLQDDGLR----------FIYVISNTYGPDGEHCL 327
            .....|.|.          .:..:.||:|    ||:
Mouse   299 LVSPADDLSLSEGTSGSSCLVAALGNTWG----HCV 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 63/282 (22%)
radB 80..335 CDD:236482 63/282 (22%)
Rad51bXP_030102481.1 Rad51_DMC1_radA 94..369 CDD:238543 63/284 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.