DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and Rad51

DIOPT Version :9

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_035364.1 Gene:Rad51 / 19361 MGIID:97890 Length:339 Species:Mus musculus


Alignment Length:343 Identity:80/343 - (23%)
Similarity:124/343 - (36%) Gaps:117/343 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DEKKLHELW--------------AINIQSVRELKKE------LSLLPKGSVDEGTPDFN------ 77
            |.|||.|..              .|||:.:.|.|.:      ..|:|.|...  ..:|:      
Mouse    37 DVKKLEEAGYHTVEAVAYAPKKELINIKGISEAKADKILTEAAKLVPMGFTT--ATEFHQRRSEI 99

  Fly    78 --YDTGIEELDKLLDSVEQPFKPGRVWELCGQPGVGKTQLLYTLALNFVWKHSQA-----VLFID 135
              ..||.:||||||   :...:.|.:.|:.|:...||||:.:|||:.......:.     .::||
Mouse   100 IQITTGSKELDKLL---QGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYID 161

  Fly   136 TKREFSCKRIQDMLRAREVDEEASERAMKGIRVVQAATGADIND---LLKSF--DH--QLTAETH 193
            |:..|..:|:.          ..:||        ...:|:|:.|   ..:.|  ||  ||..:..
Mouse   162 TEGTFRPERLL----------AVAER--------YGLSGSDVLDNVAYARGFNTDHQTQLLYQAS 208

  Fly   194 ASM---QTKLVLIDSLAACF-AFYRGRRMRDVRKSVLTELACKIRKLALR-GVAFVIGNVSFFEN 253
            |.|   :..|:::||..|.: ..|.||.....|:..|......:.:||.. |||.||.|      
Mouse   209 AMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITN------ 267

  Fly   254 NKDSCGDDGEQNGDDEEVTRQ----------QLEPMLGSYWSSVATLRLSVE------------- 295
                            :|..|          ..:|:.|:..:..:|.||.:.             
Mouse   268 ----------------QVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYD 316

  Fly   296 ---LPEEED-FTLQDDGL 309
               |||.|. |.:..||:
Mouse   317 SPCLPEAEAMFAINADGV 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 66/274 (24%)
radB 80..335 CDD:236482 66/274 (24%)
Rad51NP_035364.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
recomb_RAD51 25..339 CDD:274048 80/343 (23%)
Interaction with PALB2. /evidence=ECO:0000250 184..257 19/72 (26%)
Nuclear export signal, masked by the interaction with BRCA2. /evidence=ECO:0000250|UniProtKB:Q06609 245..260 3/14 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.