DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and rad-51

DIOPT Version :9

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001023465.1 Gene:rad-51 / 177914 WormBaseID:WBGene00004297 Length:395 Species:Caenorhabditis elegans


Alignment Length:257 Identity:65/257 - (25%)
Similarity:99/257 - (38%) Gaps:52/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 TGIEELDKLLDSVEQPFKPGRVWELCGQPGVGKTQLLYTLALNFVWKHSQAVL------------ 132
            ||...||:||..   ..:.|.:.|:.|:...|||||.          ||.|||            
 Worm   158 TGSASLDRLLGG---GIETGSITEVYGEYRTGKTQLC----------HSLAVLCQLPIDMGGGEG 209

  Fly   133 ---FIDTKREFSCKRIQDMLRAREVDEEASERAMKGIRVVQAATGADINDLLKSFDHQLTAETHA 194
               :|||...|..:||..:.:...:|   |...::.|.|.:|.....:..|:......::...:|
 Worm   210 KCMYIDTNATFRPERIIAIAQRYNMD---SAHVLENIAVARAYNSEHLMALIIRAGAMMSESRYA 271

  Fly   195 SMQTKLVLIDSLAACFA-FYRGRRMRDVRKSVLTELACKIRKLALR-GVAFVI---------GNV 248
                 :|::|...|.|. .|.||.....|:..|:.....:.|||.. |||.:|         |..
 Worm   272 -----VVIVDCATAHFRNEYTGRGDLAERQMKLSAFLKCLAKLADEYGVAVIITNQVVAQVDGGA 331

  Fly   249 SFFENNKDSCGDDGEQNGDDEEVTRQQLEPMLGSYWSSVATLRLSVELPE-EEDFTLQDDGL 309
            |.|:  .|:....|.........||..|....|.  :.||.:..|..||| |..:::.:.|:
 Worm   332 SMFQ--ADAKKPIGGHIIAHMSTTRLYLRKGKGE--NRVAKMVQSPNLPEAEATYSITNHGI 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 65/257 (25%)
radB 80..335 CDD:236482 65/257 (25%)
rad-51NP_001023465.1 PTZ00035 62..394 CDD:185407 65/257 (25%)
HHH_5 <94..132 CDD:291205
Rad51_DMC1_radA 156..390 CDD:238543 65/257 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.