DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and Dmc1

DIOPT Version :9

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_034189.1 Gene:Dmc1 / 13404 MGIID:105393 Length:340 Species:Mus musculus


Alignment Length:339 Identity:79/339 - (23%)
Similarity:142/339 - (41%) Gaps:73/339 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLSEYQLNL-----LRKNNICSLIDFYDADEKKLHELWAINIQSVRELKKELS-LLPKGSV---- 69
            ||.::.:|:     |:...||::........:.|..:..::...|.::|:..: |:..|.:    
Mouse    26 LLQKHGINMADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVEKIKEAANKLIEPGFLTAFQ 90

  Fly    70 --DEGTPDFNYDTGIEELDKLL-DSVEQPFKPGRVWELCGQPGVGKTQLLYTLALNFVWKHSQ-- 129
              :.....|:..||.:|.|||| ..:|..    .:.|..|:...|||||.:||.:.     :|  
Mouse    91 YSERRKMVFHITTGSQEFDKLLGGGIESM----AITEAFGEFRTGKTQLSHTLCVT-----AQLP 146

  Fly   130 --------AVLFIDTKREFSCKRIQDMLRAREVDEEASERAMKGIRVVQAATGADINDLLKSFDH 186
                    .::||||:..|...|::|:.....||.||   .:..:...:|.|.....:||   |:
Mouse   147 GTGGYSGGKIIFIDTENTFRPDRLRDIADRFNVDHEA---VLDNVLYARAYTSEHQMELL---DY 205

  Fly   187 QLTAETHASMQT-KLVLIDSLAACFAF-YRGRRMRDVRKSVLTELACKIRKLALRGVAFVIGNVS 249
             :.|:.|..... ||::|||:.|.|.. :.||.....|:..|.::..:::|::..      .||:
Mouse   206 -VAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEE------YNVA 263

  Fly   250 FFENNKDSCGDDGEQNGDDEEVTRQ--QLEPMLGSYWSSVATLRLSV----------------EL 296
            .|..|: ...|.|      ..:|.|  ..:|:.|...:..:|.|:|:                |:
Mouse   264 VFVTNQ-MTADPG------ATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEM 321

  Fly   297 PEEE-DFTLQDDGL 309
            ||.| .|.:...|:
Mouse   322 PENEATFAITAGGI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 67/262 (26%)
radB 80..335 CDD:236482 67/262 (26%)
Dmc1NP_034189.1 recomb_DMC1 24..338 CDD:131292 79/339 (23%)
HHH_5 25..79 CDD:291205 9/52 (17%)
Rad51_DMC1_radA 101..336 CDD:238543 67/264 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.