DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8046 and MFSD14A

DIOPT Version :9

Sequence 1:NP_724761.1 Gene:CG8046 / 35936 FlyBaseID:FBgn0033388 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_149044.2 Gene:MFSD14A / 64645 HGNCID:23363 Length:490 Species:Homo sapiens


Alignment Length:399 Identity:86/399 - (21%)
Similarity:161/399 - (40%) Gaps:97/399 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 GSWADHYGRKPLLMCSFLGYGLQYLISAAIAYCAMYTQGLVSPWWYVLSIVPLSCLGSSVTYSVA 212
            |:.:|.:|||            .:|:......||......:||||| .:::.:|.: .:||:|| 
Human    93 GALSDVWGRK------------SFLLLTVFFTCAPIPLMKISPWWY-FAVISVSGV-FAVTFSV- 142

  Fly   213 AVCFIADVSGGKVRSYRMIAYEL--AIYVGLLLGS------LGSGYAYEATDAYIVFSISAVCIF 269
            ...::||::....||   :||.|  |.:...|:.|      ||..|.    |:.:|...:|:.:.
Human   143 VFAYVADITQEHERS---MAYGLVSATFAASLVTSPAIGAYLGRVYG----DSLVVVLATAIALL 200

  Fly   270 TALFLMALLLPESLPARNRTLSTPTTDTSVVSMLKSLWSTCSKPREHQNRFMLTTIMVVLLLTAF 334
            ...|:: :.:|||||.:.|    |.:..:.:|     |.. :.|.....:....:|::::.:|.|
Human   201 DICFIL-VAVPESLPEKMR----PASWGAPIS-----WEQ-ADPFASLKKVGQDSIVLLICITVF 254

  Fly   335 VS----DGSNSVFYKFMRIKFHWTVKQFTEYETVGILVPAVAGSGGVLFIWS--------LRKCT 387
            :|    .|..|.|:.::|     .:.:|:. |:|...:..:    |:|.|.:        :|...
Human   255 LSYLPEAGQYSSFFLYLR-----QIMKFSP-ESVAAFIAVL----GILSIIAQTIVLSLLMRSIG 309

  Fly   388 NSAILWLALVSLLSHCSSSLMKGFALESWQIYVAIGLGVFKSLVNPMCRTMITNLLPADERGKIF 452
            |...:.|.|...:...:   ..||..|.|.::.|..:....|:..|....:::....||::|.:.
Human   310 NKNTILLGLGFQILQLA---WYGFGSEPWMMWAAGAVAAMSSITFPAVSALVSRTADADQQGVVQ 371

  Fly   453 ALL----GVLQALSPLISSTLYVAIYTRT-----------LNTE-----------PGIFNVFSAF 491
            .::    |:...|.|.:...::...:...           .||.           ||     ..|
Human   372 GMITGIRGLCNGLGPALYGFIFYIFHVELKELPITGTDLGTNTSPQHHFEQNSIIPG-----PPF 431

  Fly   492 LFGIGIILL 500
            |||...:||
Human   432 LFGACSVLL 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8046NP_724761.1 MFS_1 138..467 CDD:284993 76/342 (22%)
MFS 141..503 CDD:119392 86/399 (22%)
MFSD14ANP_149044.2 MFS_MFSD14 37..449 CDD:340945 86/399 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 465..490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.