DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8046 and mfsd14ba

DIOPT Version :9

Sequence 1:NP_724761.1 Gene:CG8046 / 35936 FlyBaseID:FBgn0033388 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_002663499.2 Gene:mfsd14ba / 557306 ZFINID:ZDB-GENE-200414-1 Length:500 Species:Danio rerio


Alignment Length:376 Identity:86/376 - (22%)
Similarity:151/376 - (40%) Gaps:71/376 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LVECFIPAFCGLFA-------GSWADHYGRKPLLMCSFLGYGLQYLISAAIAYCAMYTQGLVSPW 191
            |:...|....||.:       |:.:|.:||:            .:|:......||......:|||
Zfish    84 LINGLIQGVKGLLSFMSAPLIGALSDVWGRR------------SFLLVTVFFTCAPIPLMRLSPW 136

  Fly   192 WYVLSIVPLSCLGS-SVTYSVAAVCFIADVSGGKVRSYRMIAYEL--AIYVGLLLGSLGSGYAYE 253
            ||...|   |..|: |||:|| ...:||||:..:.||   .||.|  |.:...|:.|...|....
Zfish   137 WYFAMI---SVSGAFSVTFSV-IFAYIADVTDERERS---TAYGLVSATFAASLVTSPAIGAYLS 194

  Fly   254 AT--DAYIVFSISAVCIFTALFLMALLLPESLPARNR--TLSTPTTDTSVVSMLKSLWSTCSKPR 314
            |:  |..:|...:.:.:....|:: |.:|||||.:.|  |...|.:           |.. :.|.
Zfish   195 ASYGDNLVVLVATLIALADICFIL-LAVPESLPDKMRLNTWGAPIS-----------WEQ-ADPF 246

  Fly   315 EHQNRFMLTTIMVVLLLTAFVS----DGSNSVFYKFMRIKFHWTVKQFTEY-ETVGILVPAVAGS 374
            ....:....|.::::.:|.|:|    .|..|.|:.::|...:::.|....: ..||||  ::...
Zfish   247 ASLRKVGQDTTVLLICITVFLSYLPEAGQYSSFFLYLRQVINFSPKTIAVFIGVVGIL--SILAQ 309

  Fly   375 GGVLFIWSLRKC---TNSAILWLALVSLLSHCSSSLMKGFALESWQIYVAIGLGVFKSLVNPMCR 436
              .||:..|.:.   .|:.:|.|....|     .....|...|.|.::.|..:....|:..|...
Zfish   310 --TLFLTLLMRTIGNKNTVLLGLGFQIL-----QLAWYGLGSEPWMMWAAGAVAAMSSITFPAVS 367

  Fly   437 TMITNLLPADERGKIFALLGVLQALSPLISSTLYVAIYTRTLNTEPGIFNV 487
            .:::.....|::|.:..::..::.|...:...||..::.        :|||
Zfish   368 ALVSRSADPDKQGLVQGMITGIRGLCNGLGPALYGFVFF--------LFNV 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8046NP_724761.1 MFS_1 138..467 CDD:284993 80/350 (23%)
MFS 141..503 CDD:119392 84/369 (23%)
mfsd14baXP_002663499.2 MFS 52..409 CDD:119392 83/373 (22%)
MFS_1 54..398 CDD:284993 81/354 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D763423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.