DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8008 and srp54

DIOPT Version :9

Sequence 1:NP_001137623.1 Gene:CG8008 / 35935 FlyBaseID:FBgn0033387 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_988977.1 Gene:srp54 / 394574 XenbaseID:XB-GENE-960992 Length:504 Species:Xenopus tropicalis


Alignment Length:322 Identity:54/322 - (16%)
Similarity:111/322 - (34%) Gaps:71/322 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 AAICELSSYYVVNPWWYIMAAVPHSLLGGNCVFSVAAFCFISDITDCKSRPYRMIFMESLFFIGL 203
            :|:..||:..::|      ..|.:::|...|...:.|...|..:...:......|.:|.: ..||
 Frog    12 SALRSLSNATIIN------EEVLNAMLKEVCKALLEADVNIKLVKQLRENVKSAIDLEEM-ASGL 69

  Fly   204 TSGSLLSSFVYAAVGSAATIGISGCIVTFATLFIIFFV-----------PESLHFHKEQETKNAI 257
            ....::...|:..:......|:.....|.....:|.||           .:..::::.:..|..:
 Frog    70 NKRKMIQHAVFKELVKLVDPGVKAWTPTKGKPNVIMFVGLQGSGKTTTCTKLAYYYQRKGWKTCL 134

  Fly   258 TA----------NVEKECIDSKVPITACDLQLD--RVAIDCPPNFMND-------EEPGKDKRME 303
            ..          .:::....:::|......::|  .:|.:....|.|:       :..|:.|:.:
 Frog   135 ICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVNIAYEGVEKFKNENFEIVIVDTSGRHKQED 199

  Fly   304 LPTPATPAMSFDDDLL----AKYVERLPQKAEERKRQEAEEQAKKAGLFSMVHIRDMISTCFKRR 364
                     |..:::|    |...:.:....:....|..|.|||  .....|.:..:|.|   :.
 Frog   200 ---------SLFEEMLQVSNAVQPDNIVYVMDASIGQACEAQAK--AFKDKVDVASVIVT---KL 250

  Fly   365 DHHARAIIWLVTLAMFLSIFVFDGVMTVMYLFVREKFHWTVRDYTFFETVSHLVPMIGALIG 426
            |.||:....|..:|...|..:|.|...          |  :.|:..|:|    .|.|..|:|
 Frog   251 DGHAKGGGALSAVAATKSPIIFIGTGE----------H--IDDFEPFKT----QPFISKLLG 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8008NP_001137623.1 MFS 101..547 CDD:119392 54/322 (17%)
MFS_1 101..>261 CDD:284993 20/142 (14%)
MFS_1 375..>558 CDD:284993 12/52 (23%)
srp54NP_988977.1 SRP54_euk 2..430 CDD:273615 54/322 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7096
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4704
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X552
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.