DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8008 and CG11537

DIOPT Version :9

Sequence 1:NP_001137623.1 Gene:CG8008 / 35935 FlyBaseID:FBgn0033387 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster


Alignment Length:457 Identity:92/457 - (20%)
Similarity:160/457 - (35%) Gaps:139/457 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 IETELQPYVANLFLARTL---LESIVPAFCGLFIGSWSDHYGRKPLLIVSMIGFSASFLMMAAIC 142
            |.|..|.:..:.||...|   ::.|:.......||:.||.:|||..|:|::........:|:   
  Fly   275 ISTLNQTFPDHTFLMNGLVMGIKGILSFLSAPLIGALSDIWGRKFFLLVTVFFTCLPIPLMS--- 336

  Fly   143 ELSSYYVVNPWWYIMAAVPHSLLGGNCVFSVAAFCFISDIT--DCKSRPYRMIFMESLFFIGLTS 205
                   :|.||:....   |:.|...|.....|.:::|:|  :.:|:.|           ||.|
  Fly   337 -------INTWWFFAMI---SISGAFAVTFSVVFAYVADVTTPEERSKAY-----------GLAS 380

  Fly   206 GSLLSSFVYA-AVGSA--------ATIGISGCIVTFATLFIIFFVPESLHFHKEQETKNAITANV 261
            .:..:|.|.: |:|:|        ..:.:|..|......||:..|||||   .|:....:..|.:
  Fly   381 ATFAASLVISPALGNALMEMYGDTLVVALSTAIALLDVFFILVAVPESL---SEKMRPASWGAPI 442

  Fly   262 EKECIDSKVPITACDLQLDRVAIDCPPNFMNDEEPGKDKRMELPTPATPAMSFDDDLLAKYVERL 326
            ..|..|.                     |:...:.|.||.: |....|..:|:           |
  Fly   443 SWEQADP---------------------FLALRKVGTDKTV-LMLCLTVLLSY-----------L 474

  Fly   327 PQKAEERKRQEAEEQAKKAGLFSMVHIRDMISTCFKRRDHHARAIIWLVTLAMFLSIFVFDGVMT 391
            |:                ||.:|.:.:...:...|.           .|.:::|::|.   |:::
  Fly   475 PE----------------AGEYSCMFVYLKLKMGFN-----------YVEVSVFIAIV---GILS 509

  Fly   392 VMYLFVREKFHWTVRDYTFFETVSHLVPMIGALIGFLILRKVFRLSVVTLALLAFFSEILNNLAK 456
            :                |...|:...:.:.||.          |..::.|||     ||:..|..
  Fly   510 I----------------TVQVTLGSFMQVFGAK----------RTIIMGLAL-----EIVQLLWY 543

  Fly   457 GFATMPWHMYLSVTLGVFRSISGPMCRTIVSNIVPPSD----LGKIFSIKNVLQSFAPFVAAPLY 517
            ||.:..|.|:.:..:....||:.|.....||....|..    .|.|..::.:.....|.|...::
  Fly   544 GFGSQKWMMWSAGVVAALGSITYPAISAFVSLYAAPESQGAVQGMITGMRGLCNGLGPAVFGVVF 608

  Fly   518 TL 519
            .|
  Fly   609 YL 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8008NP_001137623.1 MFS 101..547 CDD:119392 86/434 (20%)
MFS_1 101..>261 CDD:284993 41/170 (24%)
MFS_1 375..>558 CDD:284993 30/149 (20%)
CG11537NP_001097489.1 MFS 256..612 CDD:119392 92/457 (20%)
MFS_1 257..601 CDD:284993 89/446 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.