DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8008 and Vmat

DIOPT Version :9

Sequence 1:NP_001137623.1 Gene:CG8008 / 35935 FlyBaseID:FBgn0033387 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001014525.1 Gene:Vmat / 3346192 FlyBaseID:FBgn0260964 Length:646 Species:Drosophila melanogaster


Alignment Length:235 Identity:49/235 - (20%)
Similarity:86/235 - (36%) Gaps:44/235 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NESDCKQLDVKNASAEINAIETELQPYVANLFLARTLLESIVPAFCGLFIGSWSDHYGRKPLLIV 126
            ||:..::|:.::.......:|..|      ||.::..::.:|....|             ||  .
  Fly   218 NETYYRELEERHNELVGETVEVGL------LFASKAFVQLLVNPIVG-------------PL--T 261

  Fly   127 SMIGFSASFLMMAAICELSSYYVVNPWWYIMAAVPHSLLG-GNCVFSVAAFCFISD-ITDCKSRP 189
            ..||:|........|..||:........|::..|..:|.| |:...||:....::| .||.|.|.
  Fly   262 HRIGYSIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERG 326

  Fly   190 YRMIFMESLFFIGLTSGSLLSSFVYAAVGSAATIGISGCIVTFATLFIIFFVPESLHFHKEQETK 254
            ..|........:|:..|......:|..||.:|...|...:.....|..:|.:..|:   ::.||:
  Fly   327 NAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQPSI---QKAETE 388

  Fly   255 -----------------NAIT-ANVEKECIDSKVPITACD 276
                             .||| ||:....::..:|:...|
  Fly   389 PPSLKSLISDPYILIAAGAITFANMGIAMLEPSLPLWMVD 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8008NP_001137623.1 MFS 101..547 CDD:119392 42/196 (21%)
MFS_1 101..>261 CDD:284993 39/179 (22%)
MFS_1 375..>558 CDD:284993
VmatNP_001014525.1 MFS 238..578 CDD:119392 46/215 (21%)
MFS_1 238..544 CDD:284993 46/215 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.