DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8008 and SLC46A1

DIOPT Version :9

Sequence 1:NP_001137623.1 Gene:CG8008 / 35935 FlyBaseID:FBgn0033387 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_542400.2 Gene:SLC46A1 / 113235 HGNCID:30521 Length:459 Species:Homo sapiens


Alignment Length:524 Identity:101/524 - (19%)
Similarity:191/524 - (36%) Gaps:129/524 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IEPVVFMLLFSHTLSGTIQRNQVIYQTCTVIFHYN----ESDCKQLDVKNASAEINAIETELQPY 88
            :||:||:..|:..|.|.: ..|.::...:....||    ...|..   ::|...:..:||....:
Human    25 VEPLVFLANFALVLQGPL-TTQYLWHRFSADLGYNGTRQRGGCSN---RSADPTMQEVETLTSHW 85

  Fly    89 VANLFLARTLLESIVPAFCGLF----IGSWSDHYGRKPLLIVSMIGFSASFLMMAAICELSSYYV 149
                    ||..::.....|||    :|:|||..||:|||:::.:|.....|:...:.:|.    
Human    86 --------TLYMNVGGFLVGLFSSTLLGAWSDSVGRRPLLVLASLGLLLQALVSVFVVQLQ---- 138

  Fly   150 VNPWWYIMAAVPHSLLGGNCVFSVAAFCFISDITDCKSRPYRMIFMESLFFIGLTSGSLLSSFVY 214
            ::..::::..:..:|||.......|:|..::|::..:||.:||..:|:...:.....|||.....
Human   139 LHVGYFVLGRILCALLGDFGGLLAASFASVADVSSSRSRTFRMALLEASIGVAGMLASLLGGHWL 203

  Fly   215 AAVGSAATIGISGCIVTFATLFIIFFVPESLHFHKEQETKNAITANVEKECIDSKVPITACDLQL 279
            .|.|.|....::..::...||:..|...|:|                                  
Human   204 RAQGYANPFWLALALLIAMTLYAAFCFGETL---------------------------------- 234

  Fly   280 DRVAIDCPPNFMNDEEPGKDKRMELPTPATPAMSFDDDLLAKYVERLPQKAEERKRQEAEEQAKK 344
                          :||                                              |.
Human   235 --------------KEP----------------------------------------------KS 239

  Fly   345 AGLFSMVHIRDMISTCFKRRDHHARAIIWLVTLAMFLSIFVFDGVMTVMYLF-VREKFHWTVRDY 408
            ..||:..|.|.::..........:|..:.|.:||:|:.|.|..|...::.|: :.....|..:..
Human   240 TRLFTFRHHRSIVQLYVAPAPEKSRKHLALYSLAIFVVITVHFGAQDILTLYELSTPLCWDSKLI 304

  Fly   409 TFFETVSHLVPMIGALIGFLILRKVFRLSVVTLALLAFFSEILNNLAKGFATMPWHMYLSVTLGV 473
            .:.....|| |.:.:|:...:|:  :.|:...:|.:.....||..:...|||:...|:....|..
Human   305 GYGSAAQHL-PYLTSLLALKLLQ--YCLADAWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLF 366

  Fly   474 FRSISGPMCRTIVSNIVPPSDLGKIFSIKNVLQSFAPFVAAPLYTLIYKRSLTTYPGLFNFVSSF 538
            ...:..|:.|..:|.:|..::.|.:||....:.|.|...|:.::.       :.||...||:..|
Human   367 LSLVITPVIRAKLSKLVRETEQGALFSAVACVNSLAMLTASGIFN-------SLYPATLNFMKGF 424

  Fly   539 LYLL 542
            .:||
Human   425 PFLL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8008NP_001137623.1 MFS 101..547 CDD:119392 85/447 (19%)
MFS_1 101..>261 CDD:284993 37/163 (23%)
MFS_1 375..>558 CDD:284993 39/169 (23%)
SLC46A1NP_542400.2 MFS 73..443 CDD:119392 89/472 (19%)
MFS_1 94..407 CDD:284993 77/413 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6826
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4780
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48502
OrthoDB 1 1.010 - - D333052at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8463
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23507
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X552
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.