DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8008 and si:ch211-262i1.4

DIOPT Version :9

Sequence 1:NP_001137623.1 Gene:CG8008 / 35935 FlyBaseID:FBgn0033387 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_021328126.1 Gene:si:ch211-262i1.4 / 101884492 ZFINID:ZDB-GENE-140106-10 Length:351 Species:Danio rerio


Alignment Length:221 Identity:53/221 - (23%)
Similarity:98/221 - (44%) Gaps:33/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IEPVVFMLLFSHTLSGTIQRNQVIYQTCTVIFHYNESDCKQLDVKNASAEINAIETELQPYVANL 92
            :||||.:     ...||......:.||.     ||.|      :|.|:.:.|    :.|...:..
Zfish     8 VEPVVVI-----NKLGTSFFEMALTQTV-----YNRS------MKAAAGDSN----QAQAMSSRF 52

  Fly    93 FLARTLLESIVPAFCGLFIGSWSDHYGRKPLLIVSMIG--FSASFLMMAAICELSSYYVVNPWWY 155
            .|.:::|.|::.....:.:...:||:|.|..|:.|.:|  .....|::...||:...::      
Zfish    53 LLIQSVLSSVMAMLSIIPLSRMADHHGPKVFLVSSQMGSVLGMFTLVIFMYCEVPLEFL------ 111

  Fly   156 IMAAVPHSLLGGNCVF--SVAAFCFISDITDCKSRPYRMIFMESLFFIGLTSGSLLSSFVYAAVG 218
            .:.::.|.|.||..:|  .|||...:|  ::.:.|..::..::..|.|....|.|||.::| .||
Zfish   112 YLGSLLHGLSGGGPMFWAGVAALASLS--SEQRKRTLKLNIVDFCFGIAGVVGGLLSGYLY-QVG 173

  Fly   219 SAATIGISGCIVTFATLFIIFFVPES 244
            .:..:..:..|.|.|.|:.:|.:.:|
Zfish   174 PSVLLLTAILITTVALLYSVFALSDS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8008NP_001137623.1 MFS 101..547 CDD:119392 36/148 (24%)
MFS_1 101..>261 CDD:284993 36/148 (24%)
MFS_1 375..>558 CDD:284993
si:ch211-262i1.4XP_021328126.1 MFS_1 57..342 CDD:331686 37/152 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48502
OrthoDB 1 1.010 - - D333052at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23507
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.