DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prp38 and PRP38

DIOPT Version :9

Sequence 1:NP_610463.2 Gene:Prp38 / 35934 FlyBaseID:FBgn0050342 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_011589.3 Gene:PRP38 / 852966 SGDID:S000003307 Length:242 Species:Saccharomyces cerevisiae


Alignment Length:243 Identity:55/243 - (22%)
Similarity:98/243 - (40%) Gaps:71/243 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KNVHGTNPQYLIEKIIRSRIYDSKYWKEQCFALTAELLVDKAME--LRFVGGVYG---------- 62
            |.::..:...:|.::.|.:|::|.|:|..   |:.|.|....|.  |:.:.|.:|          
Yeast    15 KQLNNQSVSLVIPRLTRDKIHNSMYYKVN---LSNESLRGNTMVELLKVMIGAFGTIKGQNGHLH 76

  Fly    63 ----GNIKPTQFLCLTLKMLQIQP---EKDIVVEFIKNE---EFKYVRALGAFYLRLTGAALD-- 115
                |.|   :|.|:.:|:::|:|   :.:.::. :|||   :.||:.||...|.||....|:  
Yeast    77 MMVLGGI---EFKCILMKLIEIRPNFQQLNFLLN-VKNENGFDSKYIIALLLVYARLQYYYLNGN 137

  Fly   116 -----------------CYKYLE--------PLYID------NRKLRRQNRAGQFEIVYMDEYID 149
                             .|||.:        ||.:|      |.:|.         |:::||.:|
Yeast   138 NKNDDDENDLIKLFKVQLYKYSQHYFKLKSFPLQVDCFAHSYNEELC---------IIHIDELVD 193

  Fly   150 ELLRNDRVCDIILPRIQKRSILEENNEIEPKVSVLDEDLDDELPSDEE 197
            .|...|.:..|.|.:.|...|...:.|.....|..:.|.:|:..:..|
Yeast   194 WLATQDHIWGIPLGKCQWNKIYNSDEESSSSESESNGDSEDDNDTSSE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prp38NP_610463.2 PRP38 10..172 CDD:281379 50/216 (23%)
PRP38NP_011589.3 PRP38 15..211 CDD:397446 48/211 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23142
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.