DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prp38 and CG1622

DIOPT Version :9

Sequence 1:NP_610463.2 Gene:Prp38 / 35934 FlyBaseID:FBgn0050342 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_572872.1 Gene:CG1622 / 32282 FlyBaseID:FBgn0030468 Length:398 Species:Drosophila melanogaster


Alignment Length:402 Identity:101/402 - (25%)
Similarity:157/402 - (39%) Gaps:100/402 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KEAKNVHGTNP------QYLIEKIIRSRIYDSKYWKEQCFAL-TAELLVD------KAME----- 53
            |:|...|.|.|      ...:..:|.:.|..|.|:|...|.| |...:||      |.||     
  Fly    15 KKAGKQHNTLPFWGNESSMNLNALILANIQSSSYFKVHLFKLKTYHEVVDEIYYQVKHMEPWERG 79

  Fly    54 -------LRFVGGVYG---GNIKPTQFLCLTLKMLQIQPEKDIVVEFIKNEEFKYVRALGAFYLR 108
                   ....|||.|   |.|..|.: ||..|:..::..:..:...:.:.:..|:||||..|||
  Fly    80 SRKTSGQTGMCGGVRGVGAGGIVSTAY-CLLYKLYTLRLTRKQINGLLNHTDSAYIRALGFMYLR 143

  Fly   109 LTGAALDCYKYLEPLYIDNRKLRRQNRAGQFEIVYMDEYIDELLRNDRVCDIILPR----IQKRS 169
            .|....|.|.:.|....|..::  ..:||..:::.:.:.:.:.:........:.||    |||: 
  Fly   144 YTQPPGDLYDWYEDYLQDEEEI--DVKAGGGQVLTIGQMVYQFMTKLDWFSTLFPRIPVPIQKQ- 205

  Fly   170 ILEENNE---IEPKVSVLDEDLDDELPSDE-------------EKADETNRPK---ENSTAVRRP 215
             :|:..|   .|..|:|      .:|.:..             :.||..:.|:   |..:..|..
  Fly   206 -IEKRIEQYCREQGVTV------HQLSTGRSTAGTGGGPGAAGQDADYQDYPEGGVERGSGGRGG 263

  Fly   216 RRVRSKSRSRSRERERRSGQGNSARSRDYY------------DELEDY------------DRQRN 256
            .:..|:|.:..:....|    |....||||            ...|||            :|:|.
  Fly   264 GQAGSRSNAYPQPNNYR----NDYDERDYYAAASGSSYGRGRGGYEDYPPAPLPPQMPYGERERE 324

  Fly   257 RVRNRDTHNEDYDRRQNNGRHDRERERQDRDSIRERERDGDRDRRDRER-ERERDRGRHDQ---- 316
            |.|:|| .|:||||.    |...:::...|.|.|.|.|...|.|...|| ||:||.|.:::    
  Fly   325 RDRDRD-KNKDYDRH----RSKHKKKHNHRQSSRSRSRSRSRSRHRSERHERKRDGGGYERSSKS 384

  Fly   317 RERDSRGERDRR 328
            |..:...||:||
  Fly   385 RHNEHYEERERR 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prp38NP_610463.2 PRP38 10..172 CDD:281379 46/193 (24%)
CG1622NP_572872.1 PRP38 24..205 CDD:281379 43/183 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23142
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.