DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shrb and CHMP4C

DIOPT Version :9

Sequence 1:NP_610462.3 Gene:shrb / 35933 FlyBaseID:FBgn0086656 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_689497.1 Gene:CHMP4C / 92421 HGNCID:30599 Length:233 Species:Homo sapiens


Alignment Length:238 Identity:118/238 - (49%)
Similarity:161/238 - (67%) Gaps:19/238 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFFGKMFGG----KKEVAPTTGEAIQKLRETENMLIKKQEFLEAKIEDELNIARKNASKNKRVA 61
            ||..||.|.|    |...||:..||:.:|||||.||.||||:||.:|:.|:.:|:|:.::|||.|
Human     1 MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAA 65

  Fly    62 LQALKKKKRLEKQLQQIDGTLSTIEMQREALESANTNTAVLTTMKNAADALKRAHQNMDVDKVHD 126
            |||||:|||.||||.||||||||||.||||||:::|||.||..|..||.|:|..|:|||::|:.|
Human    66 LQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDD 130

  Fly   127 MMDDIAEQQDVAREISDAISNPVAFGADLDDEDLERELDELEQENFDKEIIGIPEPTPTLPEAPT 191
            :|.:|.||||:|:|||:|.|..|.||.|.|:::|..||:|||||..:|::..|     .||..|:
Human   131 LMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNI-----RLPNVPS 190

  Fly   192 EDLPEKAKEK---------KKATTTTAVEDDDDPDMKQLLSWS 225
            ..||.:...|         .:|.::...|::|| |:|||.:|:
Human   191 SSLPAQPNRKPGMSSTARRSRAASSQRAEEEDD-DIKQLAAWA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shrbNP_610462.3 Snf7 20..193 CDD:281366 97/172 (56%)
CHMP4CNP_689497.1 Intramolecular interaction with C-terminus. /evidence=ECO:0000250 1..153 88/151 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 9/22 (41%)
Snf7 24..190 CDD:308778 96/170 (56%)
Intramolecular interaction with N-terminus. /evidence=ECO:0000250 154..233 29/85 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..233 19/66 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2777
eggNOG 1 0.900 - - E1_KOG1656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 240 1.000 Inparanoid score I3345
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53573
OrthoDB 1 1.010 - - D1490465at2759
OrthoFinder 1 1.000 - - FOG0001179
OrthoInspector 1 1.000 - - otm51487
orthoMCL 1 0.900 - - OOG6_100985
Panther 1 1.100 - - O PTHR22761
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.