DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shrb and CHM7

DIOPT Version :9

Sequence 1:NP_610462.3 Gene:shrb / 35933 FlyBaseID:FBgn0086656 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_012486.3 Gene:CHM7 / 853398 SGDID:S000003585 Length:450 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:53/214 - (24%)
Similarity:104/214 - (48%) Gaps:32/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TENML-----------IKKQEFLEAKIEDELNIARKNASKN---KRVALQALKKKKRLEKQLQQI 78
            |||.|           |.||.....|..:|.||..:....|   ||:.::..:.:...||.|.::
Yeast   232 TENDLRIASVKVGIININKQITRLRKEINESNIKLRGPEFNELPKRIRIEYKQARLLSEKHLSRL 296

  Fly    79 DGTLSTIEMQREALESANTNTAVLTTMKNAADALKRAHQNM-DVDKVHDMMDDIAEQQDVAREIS 142
            ....:.:...|..::::.||..::.|:..:.:.:|..:..: ..:||.|::|:|.|..|...|::
Yeast   297 LKFQNNLAQVRTQIDTSATNAVLIQTLSESNEVIKSINGYIGSTEKVEDLLDEIKEGHDRTEEVN 361

  Fly   143 DAISNPVAFGADLD-DEDLERELDELE--------QENFDKEIIGIPEPTPTLPEAPTEDLPEKA 198
            |.::: ...|.|.: :|::||||::||        :||.:::   :.||    .|:.:|||.::.
Yeast   362 DLLAH-YNKGQDEEAEEEIERELEQLELDEKNNNKEENKNQD---LHEP----KESSSEDLLKRL 418

  Fly   199 KEKKKATTTTAVEDDDDPD 217
            ...|..|....|:|:::.|
Yeast   419 NNLKINTNEGPVQDNENHD 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shrbNP_610462.3 Snf7 20..193 CDD:281366 45/188 (24%)
CHM7NP_012486.3 Snf7 247..381 CDD:419749 30/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.