DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shrb and VPS60

DIOPT Version :9

Sequence 1:NP_610462.3 Gene:shrb / 35933 FlyBaseID:FBgn0086656 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_010774.4 Gene:VPS60 / 852097 SGDID:S000002894 Length:229 Species:Saccharomyces cerevisiae


Alignment Length:230 Identity:60/230 - (26%)
Similarity:103/230 - (44%) Gaps:35/230 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FGKMFGGKKEVAPTTGEAIQKLRETENMLIKKQEFLEAKIEDELNIARKNASKN----------- 57
            ||  :|.||.......|:.|.:.:.:..|..:...|:.:|. :||...:|..||           
Yeast     5 FG--YGNKKSHDQLLQESNQSMNQAQQSLSNRISQLDTQIA-QLNFQLQNIQKNLQRSNNKQPSL 66

  Fly    58 KRVALQALKKKKRLEKQLQQIDGTLSTIEMQREALESANTNTAVLT--TMKNAADALKRAHQNMD 120
            ::.||:.|.|:|:||.....:|.  .:..|.:..|.:.|....::|  .:|...:|:|..:..::
Yeast    67 RKQALKILNKRKQLENMKDSLDS--QSWSMTQAQLTNDNLQNTMITINALKQTNNAMKAQYGKIN 129

  Fly   121 VDKVHDMMD---DIAEQQDVAREISDAISNPVAFGADLDDEDLERELDELEQENF---------- 172
            :||:.||.|   |:.||.|..:|:. |::|......|:.|.:|:.|||.|.||:|          
Yeast   130 IDKLQDMQDEMLDLIEQGDELQEVL-AMNNNSGELDDISDAELDAELDALAQEDFTLPTSENSLG 193

  Fly   173 ---DKEIIGIPEPTPTLPEAPTEDLPEKAKEKKKA 204
               ...::|...|...:.|.|..|..:|.|..:.|
Yeast   194 NDMPSYLLGANAPPAFIDEEPNLDTEDKNKALESA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shrbNP_610462.3 Snf7 20..193 CDD:281366 51/201 (25%)
VPS60NP_010774.4 Snf7 19..181 CDD:397437 44/165 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53573
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.