DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shrb and Chmp4c

DIOPT Version :9

Sequence 1:NP_610462.3 Gene:shrb / 35933 FlyBaseID:FBgn0086656 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_079795.1 Gene:Chmp4c / 66371 MGIID:1913621 Length:232 Species:Mus musculus


Alignment Length:234 Identity:117/234 - (50%)
Similarity:158/234 - (67%) Gaps:12/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFFGKMFGG----KKEVAPTTGEAIQKLRETENMLIKKQEFLEAKIEDELNIARKNASKNKRVA 61
            ||..||.|.|    :...||:..||:.:|||||.||.||||:||.:|:.||.:|:|:.|:|||.|
Mouse     1 MSKLGKFFKGTRSSRARAAPSAQEALARLRETEEMLAKKQEYLENRIQRELALAKKHGSQNKRAA 65

  Fly    62 LQALKKKKRLEKQLQQIDGTLSTIEMQREALESANTNTAVLTTMKNAADALKRAHQNMDVDKVHD 126
            |||||:|||.||||.|:||||||||.||||||:::|||.||..|..||.|:|..|.|||::|:.|
Mouse    66 LQALKRKKRFEKQLTQVDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKAVHDNMDLNKIDD 130

  Fly   127 MMDDIAEQQDVAREISDAISNPVAFGADLDDEDLERELDELEQENFDKEI--IGIPE-PTPTLPE 188
            :|.||.||||:|:|||:|.|..|.|....|:.:|..||:|||||..:|::  :.:|. |:.:||.
Mouse   131 LMQDITEQQDIAQEISEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA 195

  Fly   189 APTE--DLPEKAKEKKKATTTTAVEDDDDPDMKQLLSWS 225
            .|:.  .:|......:.|::..|.|||   |.|||.:|:
Mouse   196 QPSRKASMPSSVHRSRAASSRRAEEDD---DFKQLAAWA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shrbNP_610462.3 Snf7 20..193 CDD:281366 98/177 (55%)
Chmp4cNP_079795.1 Intramolecular interaction with C-terminus. /evidence=ECO:0000250 1..153 89/151 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 8/21 (38%)
Snf7 24..190 CDD:281366 94/165 (57%)
Intramolecular interaction with N-terminus. /evidence=ECO:0000250 154..232 27/81 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..232 17/58 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2770
eggNOG 1 0.900 - - E1_KOG1656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 241 1.000 Inparanoid score I3325
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53573
OrthoDB 1 1.010 - - D1490465at2759
OrthoFinder 1 1.000 - - FOG0001179
OrthoInspector 1 1.000 - - otm44285
orthoMCL 1 0.900 - - OOG6_100985
Panther 1 1.100 - - O PTHR22761
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.