DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shrb and Vps60

DIOPT Version :9

Sequence 1:NP_610462.3 Gene:shrb / 35933 FlyBaseID:FBgn0086656 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001261994.1 Gene:Vps60 / 39964 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster


Alignment Length:223 Identity:61/223 - (27%)
Similarity:112/223 - (50%) Gaps:26/223 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KMFG-GK-KEVAPTTGEAIQKLRETENMLIKKQEFLEA---KIEDELNIARKNASKN--KRVALQ 63
            ::|| || ||..|:..:.|..:......:.:|...|||   |..::::..|:..:||  |:.||:
  Fly     3 RLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKNSVKQKALR 67

  Fly    64 ALKKKKRLEKQLQQIDGTLSTIEMQREALESANTNTAVLTTMKNAADALKRAHQNMDVDKVHDMM 128
            .||:||..|:|.:.:......:|....|.:|.....|.:..||:....:|..::.:::|::.|:.
  Fly    68 VLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKINIDQIEDIQ 132

  Fly   129 DDIAEQQDVAREISDAISNPVAFG-ADLDDEDLERELDELEQENFDKEIIGIPEPTPTL------ 186
            ||:|:..:.|.|:.:|:..  .:| .::||:||:.|||.|..|      |.:.:.|..|      
  Fly   133 DDMADMFEQADEVQEALGR--TYGMPEVDDDDLQAELDALGDE------IALDDDTSYLDDVVKA 189

  Fly   187 PEAPTEDLPEKAKEKKKATTTTAVEDDD 214
            ||||:.:....:....|:|    :|.|:
  Fly   190 PEAPSREPGADSIVPGKST----IETDE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shrbNP_610462.3 Snf7 20..193 CDD:281366 50/184 (27%)
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 53/194 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22761
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.