DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shrb and chmp7

DIOPT Version :9

Sequence 1:NP_610462.3 Gene:shrb / 35933 FlyBaseID:FBgn0086656 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_957075.1 Gene:chmp7 / 393754 ZFINID:ZDB-GENE-040426-1750 Length:457 Species:Danio rerio


Alignment Length:201 Identity:53/201 - (26%)
Similarity:100/201 - (49%) Gaps:22/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GKKEVAPTT--GEAIQKLRETENMLIKKQEFL--EA-KIEDELNIARKNASKNKRVALQALKKKK 69
            |:..|:|.:  ...|.:|:.:|.:|.::.|.|  || |.:.:.....|...|::  ||:.|:..|
Zfish   218 GQGRVSPVSEVDLGIYQLQCSEKLLEERVEALGHEAEKCKQQAKSLLKEGKKSQ--ALRCLRGSK 280

  Fly    70 RLEKQLQQIDGTLSTIEMQREALESANTNTAVLTTMKNAADALKRAHQNMDVDKVHDMMDDIAEQ 134
            |:||:..::...|.|::...:.:.::.|:..|:...:....||:.:.:.:.|::..:::|.|.|.
Zfish   281 RVEKKADRLFAQLETVKGILDRIANSQTDRLVMQAYQAGVAALRISLKGVTVERAENLVDQIQEL 345

  Fly   135 QDVAREISDAISNPVAFGADLDDEDLERELDELEQENFDKEIIGIPE-----PTPTLPEAPTE-- 192
            .|...|::..:::. |..|..|.||||.||..|.:::       :||     ..||.|..|..  
Zfish   346 CDTQDEVNQTLASG-APDAGEDSEDLEEELKSLMEKS-------VPENDLFPAVPTHPITPPRKT 402

  Fly   193 DLPEKA 198
            |||:.|
Zfish   403 DLPDAA 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shrbNP_610462.3 Snf7 20..193 CDD:281366 46/182 (25%)
chmp7NP_957075.1 Snf7 232..>357 CDD:304451 30/126 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..401 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 435..457
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.