DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shrb and Chmp7

DIOPT Version :9

Sequence 1:NP_610462.3 Gene:shrb / 35933 FlyBaseID:FBgn0086656 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001102342.1 Gene:Chmp7 / 364419 RGDID:1308779 Length:450 Species:Rattus norvegicus


Alignment Length:204 Identity:59/204 - (28%)
Similarity:103/204 - (50%) Gaps:17/204 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGKKEVAPT--TGEAIQKLRETENMLIKKQEFLEAKIEDELNIARK--NASKNKRVALQALKKKK 69
            |...:|:|.  ....:.:|.::|.:|.:|.|.|..:.|.....||:  .|.| |::||::||.|:
  Rat   226 GPHAKVSPVNDVDVGVYQLMQSEQLLSQKVESLSQESERCKEEARRACRAGK-KQLALRSLKAKQ 289

  Fly    70 RLEKQLQQIDGTLSTIEMQREALESANTNTAVLTTMKNAADALKRAHQNMDVDKVHDMMDDIAEQ 134
            |.||:::.:...|.|::...:.:.::.|:..|....:....|||.:.:::.|:|...::|.|.|.
  Rat   290 RTEKRIEALHAKLDTVQGILDRIYASQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVDQIQEL 354

  Fly   135 QDVAREISDAISNPVAFGADLDDEDLERELDELEQENFDKEIIGIPE-----------PTPTLPE 188
            .|...|:|..::..|..|.|.|.|:||:|||.|.|:. .||.:.:.|           |.|.:.:
  Rat   355 CDTQDEVSQTLAGGVTNGLDFDSEELEKELDILLQDT-TKEPLDLLENPHETLYTNSVPKPRILD 418

  Fly   189 APTEDLPEK 197
            |..|...||
  Rat   419 AELEAELEK 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shrbNP_610462.3 Snf7 20..193 CDD:281366 53/185 (29%)
Chmp7NP_001102342.1 Snf7 243..394 CDD:304451 47/152 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.