DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shrb and SPBC1604.18c

DIOPT Version :9

Sequence 1:NP_610462.3 Gene:shrb / 35933 FlyBaseID:FBgn0086656 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_596622.1 Gene:SPBC1604.18c / 2539983 PomBaseID:SPBC1604.18c Length:449 Species:Schizosaccharomyces pombe


Alignment Length:198 Identity:44/198 - (22%)
Similarity:90/198 - (45%) Gaps:23/198 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AIQKLRETENMLIKKQEFLEAKIEDELNIARKNASK-NKRVALQALKKKKRLEKQLQ-------Q 77
            ::..|.:....:.::.|||..::|....:..:...| .|.:|:..|::||.|.|.|:       |
pombe   251 SVADLIQARASIAQRSEFLNEELEQLSQVLNQAVKKGEKTIAITYLRRKKILSKDLERKVSSRLQ 315

  Fly    78 IDGTLSTIEMQREALESANTNTAVLTTMKNAADALKRAHQNM-DVDKVHDMMDDIAEQQDVAREI 141
            :|..:|.|       ::|..|..:|..|.:.::||......| ..:||.|:::::.:....:.||
pombe   316 LDTIISNI-------DNAVDNKILLIAMSSGSEALDAILAQMGGTEKVEDVLENVNDTLARSEEI 373

  Fly   142 SDAISNPVAFGADLDDEDLERELDEL--EQENFDKEI-----IGIPEPTPTLPEAPTEDLPEKAK 199
            ...|........||:||.:|:|..:|  |::..:..:     :.:..|:.|.....|:...:.:|
pombe   374 DATIQTYNPQNIDLEDEAVEKEWQDLVAEEQKVEDIVSTLGNVSLKTPSDTFTLTNTDSDKKTSK 438

  Fly   200 EKK 202
            .:|
pombe   439 PEK 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shrbNP_610462.3 Snf7 20..193 CDD:281366 42/187 (22%)
SPBC1604.18cNP_596622.1 Snf7 251..403 CDD:304451 38/158 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.