DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shrb and chmp-7

DIOPT Version :9

Sequence 1:NP_610462.3 Gene:shrb / 35933 FlyBaseID:FBgn0086656 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_495933.1 Gene:chmp-7 / 174442 WormBaseID:WBGene00011976 Length:411 Species:Caenorhabditis elegans


Alignment Length:217 Identity:63/217 - (29%)
Similarity:101/217 - (46%) Gaps:24/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGKKEVAPTTGEA-IQKLRETENMLIKKQEFLEAKI---EDELNIARKNASKNKRVALQALKKKK 69
            |.:..|..|..:| :..:|:..|.|.::.:.||.|:   :::.....:...|.:  |...|:::|
 Worm   204 GSEDPVKFTEADASVVDIRKAMNKLDREIQQLEQKVKKYDEQCRACLRTGDKGR--AQNFLRQRK 266

  Fly    70 RLEKQLQQIDGTLSTIEMQREALESANTNTAVLTTMKNAADALKR--AHQNMDVDKVHDMMDDIA 132
            |.||.:...|.....:......:.||..|..||...|:...|.|.  |.|.:..||:|:.|||:.
 Worm   267 RAEKDIADKDVQYQKLLTMLHQISSAKNNKDVLQAYKSGTAAFKATLARQGLSPDKIHETMDDVV 331

  Fly   133 EQQDVAREISDAISNPVAFGADLDDEDLERELDELEQENFDKEIIGIPEPTPTLPEAPT------ 191
            ...|..:||.:|||:|.......:|.|||:||::|..:|...|.:       .||||||      
 Worm   332 NSMDEYKEIEEAISSPFVNANGFNDADLEQELEDLISDNKKNESV-------HLPEAPTNRFGLF 389

  Fly   192 --EDLPEKAK-EKKKATTTTAV 210
              |..||:.: ||:.|....|:
 Worm   390 DKEVTPEEDQLEKRLARLRQAI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shrbNP_610462.3 Snf7 20..193 CDD:281366 53/186 (28%)
chmp-7NP_495933.1 Snf7 217..384 CDD:367460 51/175 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22761
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.