DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alc and CRP1

DIOPT Version :9

Sequence 1:NP_610460.1 Gene:alc / 35931 FlyBaseID:FBgn0260972 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_012016.1 Gene:CRP1 / 856551 SGDID:S000001189 Length:465 Species:Saccharomyces cerevisiae


Alignment Length:127 Identity:37/127 - (29%)
Similarity:59/127 - (46%) Gaps:28/127 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 WDGGGKNVTISGTFSDWK-PMAMVRSHQ-NF-VTI-IDLPEGD--HQYKFCVDGEWKHDPKLKSV 219
            |..|.|:|.::|||.||: .:.:|::.: || :|: :.|...|  .|:||.|||.|......|..
Yeast    13 WPAGPKDVILTGTFDDWRGTLPLVKTAKGNFEITMPVKLANKDDTFQFKFIVDGVWCVSDSYKKE 77

  Fly   220 ENAEGQRNNLVSVRESDFEVFQALAKDSENVTNYAEKEYSQEVPQV------KPWEKVSGPP 275
            ..:||..||.:.:  :|....|.:|..|             .:|:.      || .:.:|||
Yeast    78 HVSEGIENNFLQI
--TDLVETQEVAGAS-------------RIPEAGGLLCGKP-PRSAGPP 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alcNP_610460.1 AMPK1_CBM 156..238 CDD:293169 28/82 (34%)
AMPKBI 254..341 CDD:214973 6/28 (21%)
CRP1NP_012016.1 E_set_AMPKbeta_like_N 8..90 CDD:199889 27/76 (36%)
pilus_FilE 215..>385 CDD:411258
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.