DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alc and SIP1

DIOPT Version :9

Sequence 1:NP_610460.1 Gene:alc / 35931 FlyBaseID:FBgn0260972 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_010710.4 Gene:SIP1 / 852032 SGDID:S000002830 Length:815 Species:Saccharomyces cerevisiae


Alignment Length:358 Identity:75/358 - (20%)
Similarity:119/358 - (33%) Gaps:140/358 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DDATSAVTRD--------HSSMDNNEE---EEEAAVGAEPATGSQLTGDEDDIRKTALPTVLRWD 162
            ||.|.|.|.:        .|::....|   :|.|::.:|.....::....||:.|......|...
Yeast   460 DDGTVAATTEVFIVSTDIASALKEQRELTLDENASLDSEKQLNPRIRMVYDDVHKEWFVPDLFLP 524

  Fly   163 GG--GKNVTISG--TFSDWKPMAMVRSHQNFVTIIDLPEG-------------DHQYKFCVDGEW 210
            .|  ....:|:|  |.|::.|.| ..|..|||...::..|             |.|.:..:|.|.
Yeast   525 AGIYRLQFSINGILTHSNFLPTA-TDSEGNFVNWFEVLPGYHTIEPFRNEADIDSQVEPTLDEEL 588

  Fly   211 KHDPKLK---------SVENAEG--------------QRNNLVSVRESDFEVFQALAKDSENVTN 252
            ...|:||         |..:|:|              .|::.:::|:|    |..|...|.::..
Yeast   589 PKRPELKRFPSSSRKSSYYSAKGVERPSTPFSDYRGLSRSSSINMRDS----FVRLKASSLDLMA 649

  Fly   253 YAEKE---YSQEVP------------------QVKPWEKVS------------------------ 272
            ..:.|   ||.|:|                  .|.|.|..|                        
Yeast   650 EVKPERLVYSNEIPNLFNIGDGSTISVKGDSDDVHPQEPPSFTHRVVDCNQDDLFATLQQGGNID 714

  Fly   273 ------------GPPVLPPHLLQVILNKDTPLSCEPTLLPEPN------------------HVML 307
                        ..|.||.:|....||:         :|.:.|                  ||.|
Yeast   715 AETAEAVFLSRYPVPDLPIYLNSSYLNR---------ILNQSNQNSESHERDEGAINHIIPHVNL 770

  Fly   308 NHLYALSIKDGVMVLSATHRYRKKYVTTLLYKP 340
            |||...||:|.::.::.|.||..|::|.::|.|
Yeast   771 NHLLTSSIRDEIISVACTTRYEGKFITQVVYAP 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alcNP_610460.1 AMPK1_CBM 156..238 CDD:293169 26/121 (21%)
AMPKBI 254..341 CDD:214973 33/162 (20%)
SIP1NP_010710.4 E_set <504..562 CDD:421711 15/58 (26%)
AMPKBI 687..804 CDD:214973 26/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10343
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.