DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alc and AT4G16360

DIOPT Version :9

Sequence 1:NP_610460.1 Gene:alc / 35931 FlyBaseID:FBgn0260972 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_193369.3 Gene:AT4G16360 / 827331 AraportID:AT4G16360 Length:289 Species:Arabidopsis thaliana


Alignment Length:207 Identity:71/207 - (34%)
Similarity:111/207 - (53%) Gaps:25/207 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 EDDIRKTALPTVLRWDGGGKNVTISGTFSDWKPMA-MVRSHQNFVTIIDLPEGDHQYKFCVDGEW 210
            |:...:..:||::.|..|||.:.:.|::.:||..: :.||.::|..:..||.|.::|:|.|||:|
plant    94 EEASNEQGIPTMITWCHGGKEIAVEGSWDNWKTRSRLQRSGKDFTIMKVLPSGVYEYRFIVDGQW 158

  Fly   211 KHDPKLKSVENAEGQRNNLVSVRE---------SDFEVFQALAKDSENVTNYAEKEYSQEVPQVK 266
            :|.|:|....:..|...|::.:::         |.||..|:......|:...|| :||:|     
plant   159 RHAPELPLARDDAGNTFNILDLQDYVPEDIQSISGFEPPQSPENSYSNLLLGAE-DYSKE----- 217

  Fly   267 PWEKVSGPPVLPPHLLQVILNKDTPLSCEPTLLPEPNHVMLNHLYALSIKDG--VMVLSATHRYR 329
                   |||:||||...:||........|:.||.|.||:|||||....|.|  |:.|.:|||:.
plant   218 -------PPVVPPHLQMTLLNLPAANPDIPSPLPRPQHVILNHLYMQKGKSGPSVVALGSTHRFL 275

  Fly   330 KKYVTTLLYKPI 341
            .||||.:|||.:
plant   276 AKYVTVVLYKSL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alcNP_610460.1 AMPK1_CBM 156..238 CDD:293169 27/91 (30%)
AMPKBI 254..341 CDD:214973 39/88 (44%)
AT4G16360NP_193369.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I3523
eggNOG 1 0.900 - - E1_KOG1616
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38160
Inparanoid 1 1.050 122 1.000 Inparanoid score I1970
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D956412at2759
OrthoFinder 1 1.000 - - FOG0001107
OrthoInspector 1 1.000 - - otm2602
orthoMCL 1 0.900 - - OOG6_101253
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X946
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.