DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alc and LSF1

DIOPT Version :9

Sequence 1:NP_610460.1 Gene:alc / 35931 FlyBaseID:FBgn0260972 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_566139.1 Gene:LSF1 / 821127 AraportID:AT3G01510 Length:591 Species:Arabidopsis thaliana


Alignment Length:92 Identity:27/92 - (29%)
Similarity:47/92 - (51%) Gaps:7/92 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 DDIRKTALPT---VLRWDG-GGKNVTISGTFS-DWK-PM-AMVRSHQNFVTIIDLPEGDHQYKFC 205
            ||.:....||   ...|:| .|:.|.:.|.|: :|| |: |..:....|.|.:.|.:|.:.||:.
plant   445 DDGKHDGTPTHSVTFVWNGHEGEEVLLVGDFTGNWKEPIKATHKGGPRFETEVRLTQGKYYYKYI 509

  Fly   206 VDGEWKHDPKLKSVENAEGQRNNLVSV 232
            ::|:|:|.....:..:..|..||::.|
plant   510 INGDWRHSATSPTERDDRGNTNNIIVV 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alcNP_610460.1 AMPK1_CBM 156..238 CDD:293169 25/84 (30%)
AMPKBI 254..341 CDD:214973
LSF1NP_566139.1 PDZ 76..>118 CDD:412172
DSP_laforin-like 290..435 CDD:350375
E_set_AMPKbeta_like_N 456..536 CDD:199889 22/79 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D956412at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.