DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alc and PRKAB1

DIOPT Version :9

Sequence 1:NP_610460.1 Gene:alc / 35931 FlyBaseID:FBgn0260972 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_006244.2 Gene:PRKAB1 / 5564 HGNCID:9378 Length:270 Species:Homo sapiens


Alignment Length:194 Identity:122/194 - (62%)
Similarity:146/194 - (75%) Gaps:6/194 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 ALPTVLRWDGGGKNVTISGTFSDWKPMAMVRSHQNFVTIIDLPEGDHQYKFCVDGEWKHDPKLKS 218
            |.|||.||.||||.|.:||:|::|..:.:.|||.|||.|:|||||:|||||.|||:|.|||....
Human    77 ARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPI 141

  Fly   219 VENAEGQRNNLVSVRESDFEVFQALAKDSENVTNYAEKE------YSQEVPQVKPWEKVSGPPVL 277
            |.:..|..||::.|:::|||||.||..||:..::.:|..      |.||....||.|:...||:|
Human   142 VTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPIL 206

  Fly   278 PPHLLQVILNKDTPLSCEPTLLPEPNHVMLNHLYALSIKDGVMVLSATHRYRKKYVTTLLYKPI 341
            |||||||||||||.:||:|.|||||||||||||||||||||||||||||||:||||||||||||
Human   207 PPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alcNP_610460.1 AMPK1_CBM 156..238 CDD:293169 44/81 (54%)
AMPKBI 254..341 CDD:214973 67/92 (73%)
PRKAB1NP_006244.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Glycogen-binding domain. /evidence=ECO:0000250 68..163 47/85 (55%)
AMPK1_CBM 78..161 CDD:406865 44/82 (54%)
AMPKBI 181..270 CDD:214973 66/88 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141889
Domainoid 1 1.000 133 1.000 Domainoid score I5071
eggNOG 1 0.900 - - E1_KOG1616
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38160
Inparanoid 1 1.050 255 1.000 Inparanoid score I3177
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D511710at33208
OrthoFinder 1 1.000 - - FOG0001107
OrthoInspector 1 1.000 - - otm40631
orthoMCL 1 0.900 - - OOG6_101253
Panther 1 1.100 - - LDO PTHR10343
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1739
SonicParanoid 1 1.000 - - X946
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.