DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alc and F46H5.7

DIOPT Version :9

Sequence 1:NP_610460.1 Gene:alc / 35931 FlyBaseID:FBgn0260972 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001360046.1 Gene:F46H5.7 / 180987 WormBaseID:WBGene00018522 Length:578 Species:Caenorhabditis elegans


Alignment Length:163 Identity:37/163 - (22%)
Similarity:67/163 - (41%) Gaps:31/163 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TGSTRRGTAHDDATSAVTRDHSSMDNNEEEEEAAVGAEPATGSQLTGDEDDIRKTALPTV----- 158
            |.:::..:.:|.....| |.|||......:......:...|.:...|........|:|::     
 Worm   417 TANSKIQSLNDQLIQEV-RSHSSTMTIPTDGFTISQSNQGTWNLANGSNQPCFTGAIPSIPLVSA 480

  Fly   159 LRWDGG----------GKNVT-----------ISGTFSDWK---PMAMVRSHQNFVTIIDLPEGD 199
            |.:.|.          |:|||           ::|:|.:||   ....:.|.:..|| ::|..|.
 Worm   481 LPFAGANPFIFGGANEGRNVTLTISNTEQEVYLTGSFINWKCTLKCEKLVSGKKGVT-VNLTRGR 544

  Fly   200 HQYKFCVDGEWKHDPKLKSVENAEGQRNNLVSV 232
            |:::|.::|||......:.|.|..|.:||::.|
 Worm   545 HEFRFMINGEWATSSDYQQVPNGLGGQNNIIFV 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alcNP_610460.1 AMPK1_CBM 156..238 CDD:293169 27/106 (25%)
AMPKBI 254..341 CDD:214973
F46H5.7NP_001360046.1 TDP43_N 19..82 CDD:376118
SMC_prok_A <109..444 CDD:274009 7/27 (26%)
E_set_AMPKbeta_like_N 499..577 CDD:199889 22/78 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.