DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alc and C01F6.2

DIOPT Version :9

Sequence 1:NP_610460.1 Gene:alc / 35931 FlyBaseID:FBgn0260972 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_501585.1 Gene:C01F6.2 / 177732 WormBaseID:WBGene00007222 Length:487 Species:Caenorhabditis elegans


Alignment Length:107 Identity:25/107 - (23%)
Similarity:41/107 - (38%) Gaps:30/107 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 EEEEEAAVGAEPATGS-QLTGDEDD-----------------------IRKTALPTVLRWDGGG- 165
            :|..|.:...||..|: |..|:|.|                       ::......:.||.... 
 Worm   373 QEASETSSHCEPNLGAKQTVGNEQDADIVIDDSHLFAESENECSGSILVKGGQQKVLFRWTDEKP 437

  Fly   166 ---KNVTISGTFSDWK-PMAMVRSH-QNFVTIIDLPEGDHQY 202
               .:||::|:|..|. .:.|.|:. :.|...|:||:|.|.|
 Worm   438 TTVDSVTLTGSFFGWNMNIPMKRNELKMFEVCIELPDGMHDY 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alcNP_610460.1 AMPK1_CBM 156..238 CDD:293169 16/53 (30%)
AMPKBI 254..341 CDD:214973
C01F6.2NP_501585.1 E_set_AMPKbeta_like_N 427..>486 CDD:199889 16/53 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165179
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.