DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alc and prkab1

DIOPT Version :9

Sequence 1:NP_610460.1 Gene:alc / 35931 FlyBaseID:FBgn0260972 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_002932122.1 Gene:prkab1 / 100380160 XenbaseID:XB-GENE-970882 Length:266 Species:Xenopus tropicalis


Alignment Length:267 Identity:134/267 - (50%)
Similarity:171/267 - (64%) Gaps:25/267 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GTGSTRRGTAHD---DATSAVTR--DHSSMDNNEEEEEAAVGAEPATGSQLTGDE---------- 147
            |..|:.|...|.   |:|.||::  |.:.:..:..|:.....||.:.||  |..|          
 Frog     2 GNTSSERPGPHKVRRDSTGAVSKGDDRAKILMDSPEDADMFPAEESKGS--TEKEEFLAWQHDLE 64

  Fly   148 --DDIRKTALPTVLRWDGGGKNVTISGTFSDWKPMAMVRSHQNFVTIIDLPEGDHQYKFCVDGEW 210
              |.:...|.|||.||.||||.:.:||||::|..:.::|||.||..|:|||||:|||||.|||:|
 Frog    65 VNDKMPSQARPTVFRWTGGGKEIYLSGTFNNWAKIPLIRSHNNFFAILDLPEGEHQYKFLVDGQW 129

  Fly   211 KHDPKLKSVENAEGQRNNLVSVRESDFEVFQALAKDSENVTNYAEKE------YSQEVPQVKPWE 269
            .|||......:..|..||::.|:::|||||.||..||:..::.::..      |.|:....|..|
 Frog   130 THDPAEPVTTSQLGTVNNIIQVQKTDFEVFDALMVDSQKGSDISDLSSSPPGPYQQDPYNCKLEE 194

  Fly   270 KVSGPPVLPPHLLQVILNKDTPLSCEPTLLPEPNHVMLNHLYALSIKDGVMVLSATHRYRKKYVT 334
            :...||:||||||||||||||.:||:|.|||||||||||||||||||||||||||||||:|||||
 Frog   195 RFKTPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVT 259

  Fly   335 TLLYKPI 341
            |||||||
 Frog   260 TLLYKPI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alcNP_610460.1 AMPK1_CBM 156..238 CDD:293169 42/81 (52%)
AMPKBI 254..341 CDD:214973 64/92 (70%)
prkab1XP_002932122.1 AMPK1_CBM 74..155 CDD:374631 41/80 (51%)
AMPKBI 177..266 CDD:214973 64/88 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I5018
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38160
Inparanoid 1 1.050 250 1.000 Inparanoid score I3153
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D511710at33208
OrthoFinder 1 1.000 - - FOG0001107
OrthoInspector 1 1.000 - - otm47809
Panther 1 1.100 - - LDO PTHR10343
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1739
SonicParanoid 1 1.000 - - X946
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.