DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hydr1 and abhd15a

DIOPT Version :9

Sequence 1:NP_001188892.1 Gene:Hydr1 / 35930 FlyBaseID:FBgn0033382 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_021322107.1 Gene:abhd15a / 560644 ZFINID:ZDB-GENE-131121-270 Length:469 Species:Danio rerio


Alignment Length:411 Identity:106/411 - (25%)
Similarity:162/411 - (39%) Gaps:101/411 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KRPIIACSDGPFKQY-------LIRKVPTLEN---KYWPTF----------WCVESRAQTVLASL 166
            |||...| |...::.       ||.|...|.|   |:..||          |.|.|..|||..:|
Zfish    40 KRPAERC-DSKLEEQGESAAVALICKPSALANYLLKHCMTFCKSLSIPSWNWRVSSSLQTVFGAL 103

  Fly   167 LRSKSLPRVNYRREILSLKDGGEVALDWMEEGC----------DQSAPCILILPGLTGESQAEYI 221
            ...:.  .|::.|:.|.|.|.|.|||||...|.          :.::|.:||:|...|......:
Zfish   104 WPVEC--PVHFIRDHLQLSDDGLVALDWAVVGAAHHKRRRTSSNSTSPVLLIIPNSFGRITRNVL 166

  Fly   222 KCLVFAAQQAGMRVVVFNNRGLGGIELKTPRLYCAANCEDLCEVVQHVRRTLPEKCKLGATGISM 286
            | |..||...|...|:||.|...|..|.|.||....:..||.|.|:::|...|.. ::.|...|.
Zfish   167 K-LCEAALSHGYLPVIFNRRSQNGTPLSTIRLQQFGDPTDLREAVRYIRYRQPAG-QIYAVSEST 229

  Fly   287 GGLILGNYLARKSDEARSFLSAAKIIS------------VPWDVHKGSASIEKPVINSLLGRHLA 339
            |..:|.:||....  :.|:::||..:|            ..|..|......:|            
Zfish   230 GSGLLLSYLGECG--SSSYVTAAACLSPIFRCQSWFESGPSWPFHWALLLYQK------------ 280

  Fly   340 GSLCRTLRNHLDIYRDIYQDSDIDIQRILRCKTIKEF-DALF------------TAKQFGYAHVN 391
              :|      |..|:.:..:. :.|..:....::||. :|||            |.....|...|
Zfish   281 --IC------LSRYKTVLGEL-VHIDSVFSSCSLKEMEEALFCHFSSKGVPVEGTGSWEAYWERN 336

  Fly   392 DYYSDATLHNKLDHISVPLLCLSAADDPFQ--PLDAIPIKAANQCTHVAIVITARGGHIGFLEGW 454
            |...|      :|.:::|:||:.:.|||.:  |...:|::......|..:::||.|||.||    
Zfish   337 DPLRD------IDEVAIPVLCVCSQDDPIRGDPRTTLPLELFENNPHFFLLLTACGGHCGF---- 391

  Fly   455 WPSTKDQ----YMGRLFTEYF 471
              ||.|:    :..:...|:|
Zfish   392 --STSDEGPVVWSHQALLEFF 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hydr1NP_001188892.1 Abhydrolase 140..455 CDD:304388 94/364 (26%)
Abhydrolase_1 206..453 CDD:278959 68/273 (25%)
abhd15aXP_021322107.1 PLN02511 97..412 CDD:215282 90/353 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0429
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53891
OrthoDB 1 1.010 - - D1162019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.