DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hydr1 and ABHD15

DIOPT Version :9

Sequence 1:NP_001188892.1 Gene:Hydr1 / 35930 FlyBaseID:FBgn0033382 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_937790.2 Gene:ABHD15 / 116236 HGNCID:26971 Length:468 Species:Homo sapiens


Alignment Length:388 Identity:100/388 - (25%)
Similarity:152/388 - (39%) Gaps:82/388 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 IACSDGPFKQYLIRKVPTLEN-KYWPTFWCVESRAQTVLASLLRSKSLPRVNYRREILSLKDGGE 189
            :.|......|.|:|.:...|. :..|..|......||:...:|  ...|.....||.|.|.|.|.
Human    72 LVCKPSALAQCLLRALRRSEALEAGPRSWFSGPHLQTLCHFVL--PVAPGPELAREYLQLADDGL 134

  Fly   190 VALDWMEEGCDQSAPCI---------------LILPGLTGESQAEYI-KCLVFAAQQAGMRVVVF 238
            |||||:      ..||:               |::|...|......: .||:  |.:.|...|:|
Human   135 VALDWV------VGPCVRGRRITSAGGLPAVLLVIPNAWGRLTRNVLGLCLL--ALERGYYPVIF 191

  Fly   239 NNRGLGGIELKTPRLYCAANCEDLCEVVQHVRRTLPEKCKLGATGISMGGLILGNYLARKSDEAR 303
            :.||..|..|.:|||....:..||.|.|.::|...| ...|.|.....|..:|.:||....  :.
Human   192 HRRGHHGCPLVSPRLQPFGDPSDLKEAVTYIRFRHP-AAPLFAVSEGSGSALLLSYLGECG--SS 253

  Fly   304 SFLSAAKIIS------------VPWDVHKGSASIEKPVINSLLGRHLAGSLCRTLRNHLDIYRDI 356
            |:::.|..||            :||...:|          .||.:.:|          |..|...
Human   254 SYVTGAACISPVLRCREWFEAGLPWPYERG----------FLLHQKIA----------LSRYATA 298

  Fly   357 YQDSDIDIQRILRCKTIKEF-DALFT-AKQF-----GYAHVNDYYSDATLHNKLDHISVPLLCLS 414
            .:|: :|..|:.|.::::|| :|||. .|.|     .|...||...|      :|..:||:||:.
Human   299 LEDT-VDTSRLFRSRSLREFEEALFCHTKSFPISWDTYWDRNDPLRD------VDEAAVPVLCIC 356

  Fly   415 AADDPF--QPLDAIPIKAANQCTHVAIVITARGGHIGFLE----GWWPSTKDQYMGRLFTEYF 471
            :||||.  .|...:..:..:...:..::::..|||.|||.    ..|.........|..||:|
Human   357 SADDPVCGPPDHTLTTELFHSNPYFFLLLSRHGGHCGFLRQEPLPAWSHEVILESFRALTEFF 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hydr1NP_001188892.1 Abhydrolase 140..455 CDD:304388 91/356 (26%)
Abhydrolase_1 206..453 CDD:278959 71/287 (25%)
ABHD15NP_937790.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..61
Abhydrolase 100..419 CDD:304388 93/358 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0429
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53891
OrthoDB 1 1.010 - - D1162019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.